KEGG   Psychrobacter cryohalolentis: Pcryo_0800Help
Entry
Pcryo_0800        CDS       T00350                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pcr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
942697..943290
Genome map
AA seq 197 aa AA seqDB search
MLTAKFDQLVKQLRILPGVGQKSAQRMALHLLTKKRPQGMALAQALDEAMRDIVECQRCH
SFSDEAVCPLCQDPRRDDTLLCVVETAADVMAIEQTAGYRGRYFVLGGHLSPIDGISADD
LNIEQLVWRVKQEPVEELILATGTTVEGQTTAHFISEAVSRHVNKVTRLAQGVPMGGELE
YLDSMTLGQAMQNRSFL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttgctgacagccaaatttgatcagctggtcaaacagctgcgtattttgccgggcgttggt
caaaaaagcgcccaacgtatggcgctgcatctgctcaccaaaaaacgcccacaaggcatg
gcacttgctcaagcgcttgatgaagcgatgcgtgatatcgtcgaatgtcagcgttgccat
agctttagcgatgaggctgtttgcccattatgccaagatcctaggcgtgatgatacattg
ctatgcgtggttgagactgcagctgacgtgatggcgatagagcagacggcaggctatcgt
gggcgctactttgtcttaggtggtcacttatcaccgattgatggcattagtgctgatgat
ttaaatattgagcaactggtctggcgcgtcaagcaagagcctgttgaagagctgatattg
gcgaccggtacgacggtcgaagggcaaacgaccgcgcactttatcagtgaggcagtcagt
cgtcatgtcaataaagtcacgcgtctggcgcaaggcgtaccgatgggcggtgagcttgaa
tatcttgacagcatgacccttggacaagcgatgcaaaaccgctcctttttatag

DBGET integrated database retrieval system