KEGG   Psychrobacter cryohalolentis: Pcryo_0838Help
Entry
Pcryo_0838        CDS       T00350                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr00010  Glycolysis / Gluconeogenesis
pcr00620  Pyruvate metabolism
pcr00640  Propanoate metabolism
pcr00680  Methane metabolism
pcr01100  Metabolic pathways
pcr01110  Biosynthesis of secondary metabolites
pcr01120  Microbial metabolism in diverse environments
pcr01130  Biosynthesis of antibiotics
pcr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcryo_0838
   00620 Pyruvate metabolism
    Pcryo_0838
   00640 Propanoate metabolism
    Pcryo_0838
  Energy metabolism
   00680 Methane metabolism
    Pcryo_0838
Enzymes [BR:pcr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pcryo_0838
Lipid biosynthesis proteins [BR:pcr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pcryo_0838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABE74621
JGI: Pcryo0838
UniProt: Q1QCI2
Position
991195..992916
Genome map
AA seq 573 aa AA seqDB search
MNTSPSSTTSLNTPSNHAVNTSQALTSYSDYYNNFDMNALLTEIFGENVDDRLNAYMACC
GRHVRDGRGDNIALVHEDTAGNVTRMSFAELDKASAQVASLLLSYGVQAGDQVATMLPRT
PELLTIVLATWRIGAVYQPLFTAFGYDSIKYRMDKANTKVVFTNQDNRGKFDDLAKQTKM
VLVGSKVDAQSWGDDNYADKISKQPQTIESVLLNTDAPFLQMFTSGTVGKSKGVSVPLSA
LSAFYLYMRYAIDLRADDNYWNMADPGWAYGLYYAITGPLLLGITTYFNEAGFDAANTRD
FMVRHKISNLASSPTAFRMMKSSGVFEAAHNDAAAKLSLRCANSAGETLNTEVVNWVETY
LNCKVCDQYGQTETGMTCCEHHALAHDCPVGSMGMALPGHTLVVLDDDMNILPDGEQGQL
AVVVSQSSAFYFRGYSWNEKDAFADDYYLTGDVVERHSDGSYWFSGRDDDIIITAGYRVG
PTDVENTVLEHEAVAESAAVGVPDEVRGHTIKSYVVLKDGIKGTDEIAKEIQDLVRRRLS
THAYPREVEFVKELPKTPSGKIQRFLLRSLSAA
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgaatacctctccttcaagtactacctctttaaacaccccttcaaatcatgctgtaaat
acctcacaggcgctaacgagttatagtgactattataataattttgatatgaacgcatta
ctgacagagatatttggtgaaaatgtagatgatcgtttaaacgcctatatggcgtgctgt
ggacgtcatgtacgtgacggtcgcggtgataatattgcgctagttcatgaagatacggct
ggcaatgtcacgcgtatgagctttgctgagcttgataaagcaagtgcacaggttgccagt
ttactactttcttatggcgtgcaagcgggtgaccaagtggcaactatgctaccgcgtacc
cctgagttactcaccattgtattagccacttggcggattggcgcagtctatcaaccgctg
tttaccgcctttggttatgattcgattaagtatcgaatggacaaagctaatactaaagtt
gtttttaccaatcaagacaatcgtggcaagtttgacgacttggcgaagcaaaccaaaatg
gtgttggttggtagcaaggtagatgcgcaaagctggggtgatgataactatgctgacaag
atatcaaagcagccacaaactatagaatcagtgttactaaataccgatgcaccattttta
cagatgtttacctcgggtacggttggtaagtcaaaaggcgttagtgtgccactaagcgca
ctttcggctttttatctgtacatgcgttatgcaattgacctgcgcgcggatgacaactac
tggaatatggcagatccaggctgggcgtatgggttatattatgcgattactgggccatta
ttattaggtattactacctattttaatgaagcgggcttcgatgctgccaatacccgcgac
tttatggtacgccataaaattagcaatttggcgtcttcaccgactgcatttcgtatgatg
aaatcgagtggcgtatttgaagctgctcacaatgacgcagcggctaaattatcactgcgc
tgtgccaattcagcaggcgagaccttaaataccgaagtggtcaattgggttgagacctac
ttaaactgcaaggtttgtgatcagtacggacagaccgagacaggaatgacctgctgtgag
caccatgcattggcacatgactgtccagtaggctcgatgggcatggcgctaccggggcac
acattggtggtgttagatgatgatatgaatatattacctgatggcgagcaaggacagctt
gccgtagtggtcagtcaatcgtccgcgttttatttccgcggctatagctggaatgaaaaa
gatgccttcgctgatgactattatttaacaggtgacgtggttgagcgtcatagtgatggc
agctattggttttcagggcgtgatgacgacattatcattacagcaggttaccgcgttgga
ccaaccgatgttgaaaacacagtgcttgagcatgaggcagtcgcagagtcagcggcagtt
ggggtgccagacgaagtgcgtggtcataccattaagtcttatgtggtgctaaaagatggt
atcaaaggcacagacgagattgctaaagagattcaagacttggtacgcaggcgtctatca
actcatgcttatccacgtgaggttgagtttgtgaaagagttaccaaaaaccccaagtggt
aaaattcagcgctttttgctgcgcagtttatctgcggcttaa

DBGET integrated database retrieval system