KEGG   Psychrobacter cryohalolentis: Pcryo_0999Help
Entry
Pcryo_0999        CDS       T00350                                 

Definition
(GenBank) Delta-9 acyl-phospholipid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr01040  Biosynthesis of unsaturated fatty acids
pcr01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Pcryo_0999
Enzymes [BR:pcr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Pcryo_0999
Lipid biosynthesis proteins [BR:pcr01004]
 Desaturase
  First
   Pcryo_0999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: ABE74780
JGI: Pcryo0999
UniProt: Q1QC23
Position
complement(1193457..1194860)
Genome map
AA seq 467 aa AA seqDB search
MIAKKALGLPLKGLRFAIKSGDTFVKNASIQVTRFKTRFDENKAKNSLDEMPVAKRNYAS
ASEQTELPTDVDSIDMREFEFTKAPINWIPATILVATPIAAAIITPWYLFTHQVSAPVWG
VFGAFMIWTGISITAGYHRLLSHRAYKAHPIVKNFLLLGSTFAVQGSAFDWVSGHRTHHR
HVDDRLEDPYSAKRGFFFSHMGWMLRNYPSGKFDYKNIPDLTKDRTLQIQHKYYGLWVAA
LNIGAVAAIGWLLGDVWGTLVIVGLLRLVLTHHFTFFINSLCHMFGSRPYTDTNTARDNF
FLALFTWGEGYHNYHHFFQYDYRNGVKWWQYDPTKWLIAGLSKLGLTTELRTVDDTTIKH
AEVQMQFKAAQQQIDTVTSSGIDIPHAMKSFQDRIKFEYDAFTQTVEEWQALKAKTIELK
KTEFADRLHEVEDELKQDYAKIEQKILAHNSNLKTAFRSIGESAKAA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgattgcaaaaaaagcacttggcttaccgcttaaaggcttacgtttcgctatcaaatct
ggtgacacatttgtcaaaaatgccagcattcaagtcacacgttttaaaacacgttttgat
gagaataaagcaaaaaactcactcgatgagatgccagttgccaaacgcaactatgcaagc
gcctctgagcagactgaactgcctaccgatgtagacagtatcgatatgcgtgaatttgag
tttaccaaagcaccgattaactggattccagcaactattctggtagccacgcctattgct
gcagcaattattacgccatggtatctgttcacccatcaagtcagcgcaccggtttggggc
gtatttggtgcgtttatgatttggacgggtatcagtatcacagcaggttatcaccgttta
ctatcgcatcgtgcttataaagcgcatccaatcgtcaaaaactttttattgctaggttct
acctttgcggtacagggttcagcgtttgattgggtttctggtcaccgtacgcatcatcgt
catgtcgatgatcgcttagaagacccgtactcagcgaaacgtggctttttctttagtcat
atgggctggatgctacgcaattatcctagcggaaaatttgactataaaaatatccctgac
ctgaccaaagatagaacgctgcaaattcagcataaatattacggtttatgggtcgctgca
ttgaacatcggtgcagtcgccgcgatcggttggttattgggtgatgtttggggtactttg
gtcatcgtcggtttgctacgtctggtactgacgcatcactttaccttctttatcaattcg
ctatgtcatatgtttgggtcgcgtccttataccgataccaacactgcacgtgataacttc
ttcttggctctatttacgtggggtgagggttatcataactatcatcacttcttccagtac
gattatcgtaatggcgtaaaatggtggcagtatgatccaaccaaatggctcatcgctggt
ttatcgaagctaggtttgactactgagttacgtactgttgatgacaccactatcaagcat
gctgaagtacaaatgcaatttaaagcagcgcagcagcagattgatacggtcacatcaagt
ggtattgatattcctcatgccatgaaaagcttccaagatcgtattaagtttgaatatgat
gcctttacgcaaacggttgaagaatggcaagcattaaaagcaaaaaccattgagctgaaa
aagaccgagtttgctgatcgcttgcatgaagttgaagatgagttaaagcaagattatgcc
aagattgaacaaaaaatattggcgcataacagcaacctaaaaacagcatttcgctctatt
ggcgaaagcgcaaaagcggcttaa

DBGET integrated database retrieval system