KEGG   Psychrobacter cryohalolentis: Pcryo_1041Help
Entry
Pcryo_1041        CDS       T00350                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Pcryo_1041
Enzymes [BR:pcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Pcryo_1041
Exosome [BR:pcr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pcryo_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1243998..1245608
Genome map
AA seq 536 aa AA seqDB search
MAGYILALDQGTTSSRAILYDDHARPIKMAQQPTVLKTPQAGFVEQDAQQIWQTQISCAH
DVINQAGLLATDVSSIAITNQRESIVMWDKQTGKPLAPAIIWQDRRTASYCEALAAENLT
ATPQSGTVSNNSQGDMASEVQRITGLRLDPYFSASKIAWLLDQNPKLSVRASKGEIAVGT
IDSWLIYKLTGGEHVIDVTNASRTLLYDIHKLAWSEELCARFGIPMNILPKVLPSDGDFG
KTKKGLFAKQIPIHAVLGDQQAALFGQGCLETGMAKNTYGTGCFMLMNIGQKPLLSEHKL
LTTIAWQRKSAPTRPDNLSFEQIVQSGRRMLQPPSREVTYALEGSVFMAGAIVQWLRDNL
GMFQKSGEVEDLARQVESSEEVVLLPAFTGLGAPYWRSDISASITGMSRGTTKAHIARAA
LEAVAYQTYDVLIAMQKDSPHPLTELRVDGGAANNDLLMQFQADLLNVPVLRPRDTEITA
KGAALLAGLKTGLYDDTTMKASWQVDRVFEPNMSIDVREKHLYKWQQAISRALIVP
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcaggatatattttagcgttagatcaagggacaacgtcaagtcgagctatattgtac
gatgatcatgcgcgcccaatcaaaatggcacagcagccaacggtcttaaagacaccgcaa
gccggttttgttgagcaagatgcccagcaaatttggcagacgcaaatcagctgcgctcat
gacgtcatcaatcaggcagggctactcgccaccgatgttagcagtatcgctattaccaat
cagcgtgaatctattgtcatgtgggataagcaaacaggtaagccacttgcccccgctatt
atttggcaagacaggcgtacagcgagctactgcgaagcgcttgctgctgagaacctaacc
gccacgccacaaagtggtacggttagtaataatagccaaggtgatatggcaagcgaagtg
caacgtattacaggtctgcgtttagatccatatttcagtgccagtaaaatcgcttggtta
ctagatcaaaatcctaaattaagtgtacgcgccagcaaaggtgagatagcagttggcacc
atagacagctggctgatatataagctcacaggtggtgagcatgtcatcgatgtcaccaat
gcttctcgtaccttgctatacgatatccataagctggcatggtcggaggagttgtgcgcc
cgatttggcatacccatgaatattttgcccaaagttctgccatccgatggcgactttggc
aaaactaaaaagggattatttgccaaacaaatcccaattcatgcagtattgggtgaccag
caagcagcactttttggtcaaggctgtcttgagacgggcatggctaaaaatacttatggc
actggttgttttatgctaatgaatatcggtcaaaagccgctgcttagtgaacataagcta
ctcacaactattgcatggcaacgaaaatctgcaccaactcgcccagacaatctctcgttc
gaacaaatcgtccaatctggcagacgcatgctacagcctccaagcagagaagtaacttat
gcgttagagggcagtgtttttatggcgggtgcaattgtacagtggctgcgtgacaaccta
ggtatgtttcaaaaaagcggcgaggtagaagacttggctcggcaagttgagagcagtgaa
gaggtggttttgctgccagcatttacggggttaggtgccccttattggcgttcagatatc
agtgccagtattactggtatgagtcgcggtacgaccaaagcccatattgcaagggcagca
ctcgaggcggttgcttatcaaacatacgatgtgctcattgccatgcaaaaagacagcccg
catccactcactgaattaagggtagatgggggcgcggcaaacaatgatttgttgatgcag
ttccaagcagatttattgaatgtgcctgtactgcgtccaagagacacagagattactgca
aaaggagccgctctacttgctggcttaaaaacaggtttatatgatgatacaacgatgaag
gcctcatggcaggtagatcgagtttttgagcctaatatgtctatagatgtgcgtgaaaag
catctgtataaatggcaacaagctatcagtagagcattaatagtgccttga

DBGET integrated database retrieval system