KEGG   Psychrobacter cryohalolentis: Pcryo_1041Help
Entry
Pcryo_1041        CDS       T00350                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pcr00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1243998..1245608
Genome map
AA seq 536 aa AA seqDB search
MAGYILALDQGTTSSRAILYDDHARPIKMAQQPTVLKTPQAGFVEQDAQQIWQTQISCAH
DVINQAGLLATDVSSIAITNQRESIVMWDKQTGKPLAPAIIWQDRRTASYCEALAAENLT
ATPQSGTVSNNSQGDMASEVQRITGLRLDPYFSASKIAWLLDQNPKLSVRASKGEIAVGT
IDSWLIYKLTGGEHVIDVTNASRTLLYDIHKLAWSEELCARFGIPMNILPKVLPSDGDFG
KTKKGLFAKQIPIHAVLGDQQAALFGQGCLETGMAKNTYGTGCFMLMNIGQKPLLSEHKL
LTTIAWQRKSAPTRPDNLSFEQIVQSGRRMLQPPSREVTYALEGSVFMAGAIVQWLRDNL
GMFQKSGEVEDLARQVESSEEVVLLPAFTGLGAPYWRSDISASITGMSRGTTKAHIARAA
LEAVAYQTYDVLIAMQKDSPHPLTELRVDGGAANNDLLMQFQADLLNVPVLRPRDTEITA
KGAALLAGLKTGLYDDTTMKASWQVDRVFEPNMSIDVREKHLYKWQQAISRALIVP
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcaggatatattttagcgttagatcaagggacaacgtcaagtcgagctatattgtac
gatgatcatgcgcgcccaatcaaaatggcacagcagccaacggtcttaaagacaccgcaa
gccggttttgttgagcaagatgcccagcaaatttggcagacgcaaatcagctgcgctcat
gacgtcatcaatcaggcagggctactcgccaccgatgttagcagtatcgctattaccaat
cagcgtgaatctattgtcatgtgggataagcaaacaggtaagccacttgcccccgctatt
atttggcaagacaggcgtacagcgagctactgcgaagcgcttgctgctgagaacctaacc
gccacgccacaaagtggtacggttagtaataatagccaaggtgatatggcaagcgaagtg
caacgtattacaggtctgcgtttagatccatatttcagtgccagtaaaatcgcttggtta
ctagatcaaaatcctaaattaagtgtacgcgccagcaaaggtgagatagcagttggcacc
atagacagctggctgatatataagctcacaggtggtgagcatgtcatcgatgtcaccaat
gcttctcgtaccttgctatacgatatccataagctggcatggtcggaggagttgtgcgcc
cgatttggcatacccatgaatattttgcccaaagttctgccatccgatggcgactttggc
aaaactaaaaagggattatttgccaaacaaatcccaattcatgcagtattgggtgaccag
caagcagcactttttggtcaaggctgtcttgagacgggcatggctaaaaatacttatggc
actggttgttttatgctaatgaatatcggtcaaaagccgctgcttagtgaacataagcta
ctcacaactattgcatggcaacgaaaatctgcaccaactcgcccagacaatctctcgttc
gaacaaatcgtccaatctggcagacgcatgctacagcctccaagcagagaagtaacttat
gcgttagagggcagtgtttttatggcgggtgcaattgtacagtggctgcgtgacaaccta
ggtatgtttcaaaaaagcggcgaggtagaagacttggctcggcaagttgagagcagtgaa
gaggtggttttgctgccagcatttacggggttaggtgccccttattggcgttcagatatc
agtgccagtattactggtatgagtcgcggtacgaccaaagcccatattgcaagggcagca
ctcgaggcggttgcttatcaaacatacgatgtgctcattgccatgcaaaaagacagcccg
catccactcactgaattaagggtagatgggggcgcggcaaacaatgatttgttgatgcag
ttccaagcagatttattgaatgtgcctgtactgcgtccaagagacacagagattactgca
aaaggagccgctctacttgctggcttaaaaacaggtttatatgatgatacaacgatgaag
gcctcatggcaggtagatcgagtttttgagcctaatatgtctatagatgtgcgtgaaaag
catctgtataaatggcaacaagctatcagtagagcattaatagtgccttga

DBGET integrated database retrieval system