KEGG   Psychrobacter cryohalolentis: Pcryo_1292Help
Entry
Pcryo_1292        CDS       T00350                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pcryo_1292
Enzymes [BR:pcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Pcryo_1292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1576727..1578922
Genome map
AA seq 731 aa AA seqDB search
MSNNNNKSRAGVSLQESWASNISDYILLRRQQTHLAYNVTEAKANADSKQIDKTEQNGLF
TALFVMLATHLEEGHTVLTIEAAEHEHPIQGQINGELVTLYAWQQQLLEMLATPILALID
IQTVTQQEDDSTAGLSLFILLDIMFGKRAQLWAQLALTNREKEILSKRFDAVAALYQIVK
NTNLNSFIQSIHEHTLFADANSNVNNKNSLSKNNQPIVYQHINEPEADTQNIKITFWLHR
AWQAEFNLAQHINTILNQQITPLEIAIPENLHEQQVMAINVANNNAFSIITGGPGTGKTY
TVAQLVIALQQAAESGGDEHGKIRFSTDSASLALAAPTGKAAQRMQESLQAALDGSNVEL
QLQEAKTIHRLLGIGRTGRPRYNANNPLGEDIIIVDEASMLGVELANYLVSAVKPGARLI
LLGDANQLAAVDAGAVLADLCCIPLLQPIHAKLTESRRFSADSGIGKLANQINKTEADTQ
AIWQLLRQDKALSFQYVNTLQTEIAIDNKIKNSLSNYKILSNLTLSYHQYLNRVESLLKN
PIEKSVPELVKSTITSLMQTFNQFRVLSAGHNGEWGDHYINNHITQWHLTKLKLPLGQNT
WFHGRPVMVLQNNYELGLFNGDIGFCLQTGDGRSRLEVFFENKAQGIAVNLLNEDVIATA
YAMTIHKSQGSEFDHVAITFDNSHARLLSKELIYTAVTRAKKQVTIYSTKHAFEKAVQTP
TERNTGLALQF
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataataacaataagagcagagcgggcgttagcttacaagaaagctgggctagt
aacatcagtgattatatattgctgcgccgtcagcaaacgcacttagcgtataacgtcact
gaggcaaaggctaatgctgatagtaagcaaatcgataagacggaacaaaatggcttattt
actgctttattcgttatgttggccactcatttagaagagggacatactgtactcaccatt
gaggcagctgagcatgaacatccaatacaaggtcaaatcaatggcgagctagtcacccta
tatgcctggcagcagcaactattagagatgctagcaacaccaatcctagcactgattgac
attcaaacagttactcagcaagaggatgattctacagctgggttatcattatttatcctg
ctagacatcatgtttggtaagcgagctcagctatgggcacagctagcactcaccaatcgt
gaaaaagagatactcagcaaacgctttgatgcggttgctgcactttatcagatagtgaaa
aacacgaatctgaattccttcattcagtctattcatgagcatactttgttcgctgacgct
aattctaacgtgaataataaaaatagcctaagcaaaaataatcaacctattgtgtatcag
catattaatgaaccagaagctgatacacaaaatattaagatcactttttggttacatcga
gcttggcaagcagaattcaacttagcacagcacatcaatactattttgaaccaacagata
acccctttagagatagcgataccggaaaacctacatgagcagcaggtaatggctattaat
gtcgctaataacaatgcctttagcattattactggtggtcccggtacagggaagacctat
acggttgctcaattagtaattgctctgcaacaagctgcagagagtgggggtgatgagcat
ggaaaaattcggttcagtacagacagtgccagcctagccttagcagcaccgactggtaag
gctgcccagcgaatgcaagagtctttgcaagcggctctagatggatcgaatgtagagcta
caactgcaagaagccaagaccattcatcgcttattaggcattggtcgaacaggtagacca
cgttacaatgcaaataatccactcggcgaagatattatcattgtcgatgaggcatctatg
ttgggggtggaactggctaattaccttgtaagtgcggtaaaaccgggcgcaaggcttata
ttgttaggagatgcgaaccagctagccgcagtagatgctggggcagtattggctgactta
tgctgcattccattgctacaacctatacatgcaaagctaacagagagtcgccgatttagc
gcagactcagggattgggaagcttgccaatcaaattaataagacagaggcagatactcaa
gctatttggcagttgttaaggcaggacaaggcactgagttttcaatatgtaaatacgttg
caaacagagatagctatagataataagataaaaaatagcctaagcaattataaaattctc
tcgaacctcactttaagttatcatcaatacctgaatagagttgaatcactactaaagaat
ccaatagaaaaatccgtgccagaattagtaaaaagtacaattacttcattaatgcaaacg
tttaatcagtttagagtcctaagtgctggtcataatggcgagtggggtgatcactacatt
aataatcatatcactcaatggcatcttactaagctaaagctaccgctaggtcaaaataca
tggtttcatggtcgtcccgttatggttttacaaaacaactatgaacttggattatttaat
ggcgatattggtttttgcttgcaaacaggagatggaagaagccgacttgaggtgttcttt
gagaataaagcacagggaattgctgtcaatctgctaaatgaagacgttatagccacagca
tatgcaatgaccattcataaatcgcaggggtctgagtttgatcatgtggccattactttt
gataatagtcatgcaaggcttttgagcaaagagcttatttatacggcggtaacccgtgct
aaaaaacaggtgacaatatatagtacaaaacatgctttcgaaaaagccgttcagacaccg
actgagcgcaatacgggtttggcattgcagttttag

DBGET integrated database retrieval system