KEGG   Psychrobacter cryohalolentis: Pcryo_1405Help
Entry
Pcryo_1405        CDS       T00350                                 

Definition
acetylornithine aminotransferase
Orthology
K00818  
acetylornithine aminotransferase [EC:2.6.1.11]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Pcryo_1405
   01230 Biosynthesis of amino acids
    Pcryo_1405
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Pcryo_1405
Enzymes [BR:pcr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     Pcryo_1405
Amino acid related enzymes [BR:pcr01007]
 Aminotransferase (transaminase)
  Class III
   Pcryo_1405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1724812..1725993
Genome map
AA seq 393 aa AA seqDB search
MSATYLMPTYLRQPISFTRGSGSWLYTQDETPYLDALTGIAVCGLGHCHPQVTEAIQQQA
ATLVHTSNLFGIDWQERAGEALCNAAQMDSVFFANSGAEANEAALKLARLYAHQQGFKRP
KVIVMEQSFHGRTLLSLSATANPKAREGFYTLDNDFIRVPFGDIAAIKQAAHDYEDICAV
FVEPIQGEGGLNTAANGFTYLEQIQAVCDTHNWLFMLDEVQTGNGRTGKYFAYQHSSARP
DVLTTAKGLGNGFPVGACMVRGRANGLFGAGSHGSTYGGTPLASRVVHSVYDVLANSDIM
QNAVNEGQFIRDSMVDAFGQYGVSSRGAGMMIGIALPEDMDCSKLVDRARDEQKLIINVT
GGHVIRLLPPLNMSRNESSQVVERLVNLLKPSF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctacttacctgatgcccacttatcttcgtcaacctatcagttttacccgcggc
tcaggaagctggctctatactcaagatgagacgccttatctagacgcattgactggtatc
gcggtatgtggtttaggacattgccatccacaagtaaccgaagctattcaacagcaggca
gcaacattggttcataccagtaatttatttggtatagactggcaagagcgtgctggtgaa
gcattatgtaatgccgcgcaaatggacagtgtattttttgccaatagtggcgctgaagca
aatgaagcagcactaaaattggcgcgtctatacgcacatcaacagggttttaagcgtcca
aaagtcattgtgatggagcaatctttccatggtcgtaccttattatcattatcagcaact
gccaaccccaaagcgcgcgaaggcttttacactttagataatgattttatccgtgtgcca
tttggggatattgccgccattaaacaagcagctcatgactatgaggatatttgcgcggta
ttcgtagagcctattcaaggtgaaggtggtcttaatacggcagctaacggctttacttac
cttgagcagatacaagccgtatgcgatacacataattggctgttcatgcttgatgaagta
cagacaggcaatggacgaacaggtaagtattttgcttatcagcatagcagcgcacgccct
gatgtattaacgacggctaaaggcttaggtaatggctttcctgtcggtgcctgtatggta
cgtggtcgcgctaatggcttatttggagctggtagtcatggctcaacctatggtggtaca
ccgttagccagtcgtgtggtacatagcgtatatgacgtattggcgaacagtgatatcatg
caaaacgccgtcaacgagggacagtttattcgtgatagcatggttgatgcatttggacaa
tatggcgtcagcagtcgcggcgctgggatgatgattggcattgccctaccagaagacatg
gactgtagcaagcttgtcgatcgtgctcgtgatgagcagaaacttatcatcaatgttaca
ggcggtcatgtaattcgtttgctaccaccacttaatatgagccgtaatgaaagctcacaa
gtagttgaacgcttggttaatttactaaaaccttcgttttaa

DBGET integrated database retrieval system