KEGG   Psychrobacter cryohalolentis: Pcryo_1405Help
Entry
Pcryo_1405        CDS       T00350                                 

Definition
acetylornithine aminotransferase
Orthology
K00818  
acetylornithine aminotransferase [EC:2.6.1.11]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:pcr01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pcr01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pcr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1724812..1725993
Genome map
AA seq 393 aa AA seqDB search
MSATYLMPTYLRQPISFTRGSGSWLYTQDETPYLDALTGIAVCGLGHCHPQVTEAIQQQA
ATLVHTSNLFGIDWQERAGEALCNAAQMDSVFFANSGAEANEAALKLARLYAHQQGFKRP
KVIVMEQSFHGRTLLSLSATANPKAREGFYTLDNDFIRVPFGDIAAIKQAAHDYEDICAV
FVEPIQGEGGLNTAANGFTYLEQIQAVCDTHNWLFMLDEVQTGNGRTGKYFAYQHSSARP
DVLTTAKGLGNGFPVGACMVRGRANGLFGAGSHGSTYGGTPLASRVVHSVYDVLANSDIM
QNAVNEGQFIRDSMVDAFGQYGVSSRGAGMMIGIALPEDMDCSKLVDRARDEQKLIINVT
GGHVIRLLPPLNMSRNESSQVVERLVNLLKPSF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctacttacctgatgcccacttatcttcgtcaacctatcagttttacccgcggc
tcaggaagctggctctatactcaagatgagacgccttatctagacgcattgactggtatc
gcggtatgtggtttaggacattgccatccacaagtaaccgaagctattcaacagcaggca
gcaacattggttcataccagtaatttatttggtatagactggcaagagcgtgctggtgaa
gcattatgtaatgccgcgcaaatggacagtgtattttttgccaatagtggcgctgaagca
aatgaagcagcactaaaattggcgcgtctatacgcacatcaacagggttttaagcgtcca
aaagtcattgtgatggagcaatctttccatggtcgtaccttattatcattatcagcaact
gccaaccccaaagcgcgcgaaggcttttacactttagataatgattttatccgtgtgcca
tttggggatattgccgccattaaacaagcagctcatgactatgaggatatttgcgcggta
ttcgtagagcctattcaaggtgaaggtggtcttaatacggcagctaacggctttacttac
cttgagcagatacaagccgtatgcgatacacataattggctgttcatgcttgatgaagta
cagacaggcaatggacgaacaggtaagtattttgcttatcagcatagcagcgcacgccct
gatgtattaacgacggctaaaggcttaggtaatggctttcctgtcggtgcctgtatggta
cgtggtcgcgctaatggcttatttggagctggtagtcatggctcaacctatggtggtaca
ccgttagccagtcgtgtggtacatagcgtatatgacgtattggcgaacagtgatatcatg
caaaacgccgtcaacgagggacagtttattcgtgatagcatggttgatgcatttggacaa
tatggcgtcagcagtcgcggcgctgggatgatgattggcattgccctaccagaagacatg
gactgtagcaagcttgtcgatcgtgctcgtgatgagcagaaacttatcatcaatgttaca
ggcggtcatgtaattcgtttgctaccaccacttaatatgagccgtaatgaaagctcacaa
gtagttgaacgcttggttaatttactaaaaccttcgttttaa

DBGET integrated database retrieval system