KEGG   Psychrobacter cryohalolentis: Pcryo_1425Help
Entry
Pcryo_1425        CDS       T00350                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pcr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1750981..1751592
Genome map
AA seq 203 aa AA seqDB search
MAAKLMSNTATIASDYQESIESYRQLIASTGEDLHRPGLEDTPTRAAKAFAHLTKGYHQS
LDEVVNDALFPSTNRELVLVQNIEFYSLCEHHMLPFHGVAHIGYLPNGQVLGLSKFARIV
DMFSRRLQVQENLSEQIAQTIMDVTGCRGVAVVMDAAHMCMMMRGVNKQHSTTRTMSMLG
EYVHDNQARNEFLDAVPKRKPAF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaaacttatgagcaatactgcaacaatagcatcagactaccaagaaagcatc
gaatcctatcgccagctcatcgcctcaacgggtgaggacttgcatcgtccaggacttgaa
gacaccccaacacgtgctgccaaagcatttgcgcatttgaccaaaggctatcatcaaagc
ttagatgaagtcgttaatgacgctttgtttccatcgaccaaccgtgagctggtattggtg
caaaatattgagttttattcattgtgcgagcaccatatgttgccttttcacggtgttgcg
cacattggttatttaccaaacggtcaagtgttagggctgtctaaatttgctcgtatcgtc
gatatgttttctcgtcgcttgcaagttcaagaaaatttaagcgaacaaatagcgcagacg
attatggatgtgacaggttgccgcggtgtagctgtcgtgatggatgccgctcacatgtgt
atgatgatgcgcggtgtcaataagcaacactctactacgcgcacaatgtcgatgttaggt
gagtatgtacatgacaatcaagcgcgcaatgagtttttagatgctgtaccgaagcgtaaa
cctgctttttaa

DBGET integrated database retrieval system