KEGG   Psychrobacter cryohalolentis: Pcryo_1428Help
Entry
Pcryo_1428        CDS       T00350                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Pcryo_1428
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcryo_1428
  Lipid metabolism
   00071 Fatty acid degradation
    Pcryo_1428
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pcryo_1428
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pcryo_1428
   00626 Naphthalene degradation
    Pcryo_1428
Enzymes [BR:pcr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pcryo_1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1754899..1756224)
Genome map
AA seq 441 aa AA seqDB search
MKKQNSIAKLVSNKLVSTDGLQHAGYLAVAKTRAKVLKAFAYVIPIRRPMLFVGESSCDE
LCDMLINEGSTNVFIVTDAVLNKLGIPAKVTDYLDSKNIRYKVYDGITPDPTFKVVEEGL
RISVDAKCDSIIAIGGGSVIDAAKMIAMSQGNNCKPQQLIGILKARKPSVPLYCVPTTAG
TGSEATLGAVVSDDKTHQKALSIDPRMVPLAAAIDPVIMKGMPAHITADTGIDVLTHALE
AWMSANASVETDYYAASAVKSVMQNLPVVYKDGGNLKAREAMGIAAHYGGIAFNKAGLGY
VHAIAHQLGAYYSIPHGRANAIVLPYVLDVNRQASKKRLADLARKTGMVKDGQAGKSDAV
IADNLIAQVRELIATLNIDPTVKGMKTTDFDSIAKAAAKEVSDTYAVPTYLSASEIKSIL
TKIQQASDEHADTDVKSDKVA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaaaatagtattgctaaattagtaagtaataagttagtaagtaccgatgga
ttacagcatgctggctatttagccgttgccaagacacgcgccaaagtactaaaagccttt
gcttatgttatcccgattagaagaccgatgttattcgtcggcgaaagctcttgtgatgag
ctatgcgacatgcttattaatgaaggtagcaccaatgtctttatcgtcactgatgcggta
ttgaataagcttggtatacctgcaaaagtcactgattatctagatagcaaaaatatccgc
tataaagtctatgacggtattacgccagaccctacttttaaagtggttgaagaagggcta
cgcatctccgttgatgctaaatgcgattctattattgctatcggcggcggctctgtgatt
gatgcagctaaaatgattgctatgtcacaaggtaacaactgcaagccgcagcaacttatc
ggcattcttaaagcacgaaagccttctgtaccgctgtactgtgtgcctacaactgcgggt
actggttcggaagcgacacttggtgcagttgtatcagatgataaaacccatcaaaaagca
ctatctatcgacccaagaatggtgccattagccgccgctattgacccagttattatgaaa
gggatgccggctcatatcacagcggatacgggtatcgatgtgttgacccacgccttagaa
gcttggatgagtgctaatgcgagcgtcgagaccgactattatgcggcttctgcggtgaag
tcagttatgcagaatctgccagtagtatataaagacggcggcaatctcaaagccagagaa
gcaatgggtattgccgctcactacggcggtattgcctttaataaagcgggccttggctat
gtccatgccatcgctcatcagcttggtgcgtattatagtattccgcatggtcgcgccaat
gccatcgtgttaccttatgtacttgatgtcaatcgtcaagcaagcaaaaagagactagca
gatctggctagaaaaacgggtatggttaaggatggtcaagccggcaagagtgatgctgtg
attgcagataatctgattgcgcaagttcgcgaattgatcgctactttaaatattgatcca
acggttaaaggtatgaaaaccactgactttgatagcattgctaaagccgcagctaaagaa
gtcagcgatacttatgcggtgccaacgtatctgtcagcatctgaaatcaagagcatttta
acgaagattcagcaagccagtgatgagcatgccgatactgatgttaagagcgataaagtt
gcatag

DBGET integrated database retrieval system