KEGG   Psychrobacter cryohalolentis: Pcryo_1760Help
Entry
Pcryo_1760        CDS       T00350                                 

Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr00860  Porphyrin and chlorophyll metabolism
pcr01100  Metabolic pathways
pcr01110  Biosynthesis of secondary metabolites
pcr01120  Microbial metabolism in diverse environments
Module
pcr_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pcryo_1760
Enzymes [BR:pcr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Pcryo_1760
Exosome [BR:pcr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pcryo_1760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ABE75537
JGI: Pcryo1760
UniProt: Q1Q9W6
Position
2179346..2180353
Genome map
AA seq 335 aa AA seqDB search
MTYTFNRQFPETRLRRLRYNDNIRAMIREVELHPKHFIAPVFVLEGTNERQKIASMPGVE
RLSIDLLIKHAKDLLSEGVTTIDIFPVIDNSLKTPDGRSAYDENALTARAVKAVKDAVSE
MVVMTDVALDPYTSHGQDGLLDNSGYVVNDATVEVLVKQALVHARAGADIISPSDMMDGR
IKAMRDAFEAEGFVNTAIMAYSAKYASAYYGPFRDAVGSAGNLKGGHKKQYQMDFGNRAE
ALHEVAMDINEGADMVMIKPGQPYLDLIREVKNTFGVPTFAYQVSGEYAMHMAAIQNGWL
TDAVILESLIGFRRAGADGILTYFALEAARQLNNA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgacttatacttttaaccgccaattccctgaaactcgcctacgtcgtttgcgttataac
gacaatatacgggcgatgattcgtgaagttgagctgcatcccaagcactttatcgcgccc
gtttttgtattagaaggtactaacgagcgtcaaaaaatcgctagtatgccgggggttgag
cgcttatcgatagacctgctcattaagcacgccaaagacttgttaagtgaaggcgtcacg
accatcgatatcttcccagtaattgataactcactaaaaacccctgatggtaggtctgct
tatgatgaaaacgctctcactgcacgtgcggtaaaagcggtcaaagatgctgtgtcagag
atggtcgtcatgaccgatgtggcattggacccttatacctcacacggtcaagatggcttg
ctggataactcaggctatgtcgtaaatgatgcaacggttgaagtattggtcaagcaagcg
ctcgtccatgcacgtgctggcgctgatatcatctcacccagtgacatgatggatggtcgt
atcaaagccatgcgtgatgcctttgaagctgaaggttttgtgaataccgctatcatggcg
tattcagcaaaatacgcttctgcttattacggtccattccgtgatgcggtcggtagtgcg
ggcaatttaaaaggtgggcataagaagcagtatcagatggactttggtaatcgtgctgaa
gcgctacacgaagttgccatggacattaatgaaggcgcggatatggtgatgattaaaccg
ggtcagccatacttggatttaatccgtgaagtcaaaaatacctttggtgtaccaacgttt
gcataccaagtctctggtgaatatgccatgcatatggcagcgattcaaaacggctggctc
acggatgcggtgattttagaatcactcattggcttccgccgtgcaggtgccgatggtatc
ttgacctattttgcattagaagcggcaagacagctgaataacgcttaa

DBGET integrated database retrieval system