KEGG   Psychrobacter cryohalolentis: Pcryo_1828Help
Entry
Pcryo_1828        CDS       T00350                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Pcryo_1828
Enzymes [BR:pcr01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Pcryo_1828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2257246..2258268
Genome map
AA seq 340 aa AA seqDB search
MQNKSIPSLPSMNRQPLGFFPTPLIELTRLSKALDGPKIYMKRDDNTGLALGGNKTRKLE
FIIGDALAQGADTIVTAGAAQSNHCRQTAAAAASLGLECHLVLGGQEPEQLQGNLLLDKI
FGCHIHWAGSNRKGEDIPDIVEQLKKEGKKPYIVPYGGSSELGAFAFVEAFKELELQRQE
MDISFTHIVFASSSGGTQAGLMLGNKIFNSPYQVVGINIDKSETDKVPFDQYIISLTNST
AALIGADYTFSEADLVLNSDYVGDGYGVIGALENEAIAMTAQMEGILLDPVYTGRAMGGL
LDMIRTGKIKKTDSVLFWHTGGAPALFAYASDLAVSQSDS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataaatctataccaagcctgccgagtatgaatcggcaacctttagggtttttc
ccaacgccgttgattgagctgaccagattaagcaaagcactcgatggtcctaaaatttat
atgaaacgcgatgacaatacgggactggcattaggcggtaataaaaccagaaagcttgaa
tttatcattggggacgctcttgctcaaggtgcggatacaatcgtgacagcaggtgccgcg
cagtcaaaccattgtcgccagaccgcagctgccgcagccagtttgggacttgaatgccat
ttagttttgggtggacaagaaccagaacagttgcaaggcaatctcttactggataagatt
tttggctgtcatatccactgggcaggcagcaaccgtaaaggggaagacatacctgatatc
gtagaacaactcaaaaaagaaggtaagaaaccttacattgttccttatggcggctcaagc
gagctcggtgcttttgcctttgttgaagcgtttaaagagcttgaattacaacgtcaagag
atggatatctcattcacgcatatcgtttttgcctccagctccggcgggacacaagcgggc
ttgatgctgggcaataaaatctttaactcgccttatcaggtagtgggcatcaatattgat
aaaagtgaaaccgataaagtgccgtttgatcagtatatcatctccctcaccaatagcacg
gcggcattgattggggcagattacaccttctcagaggcagatttagtgcttaactctgat
tatgtgggagacggttatggagtgattggtgcactagaaaatgaagccattgccatgacc
gcgcaaatggaagggatattattagatcctgtttatacaggtcgtgcgatgggcggacta
ctcgatatgattcgtaccggtaaaatcaaaaaaacggacagtgtgttgttttggcatact
ggcggcgcgcccgctttatttgcttatgctagtgatttagcagtatctcaaagcgatagt
taa

DBGET integrated database retrieval system