KEGG   Psychrobacter cryohalolentis: Pcryo_1860Help
Entry
Pcryo_1860        CDS       T00350                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr00630  Glyoxylate and dicarboxylate metabolism
pcr01100  Metabolic pathways
pcr01110  Biosynthesis of secondary metabolites
pcr01120  Microbial metabolism in diverse environments
pcr01200  Carbon metabolism
Module
pcr_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pcryo_1860
Enzymes [BR:pcr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Pcryo_1860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: ABE75637
JGI: Pcryo1860
UniProt: Q1Q9L6
Position
2296421..2298007
Genome map
AA seq 528 aa AA seqDB search
MSTAYKSAIDLVRELKQKHGNWQNISETDAARMMAQNRFKTGLDIAKYTAKIMRQDMEEY
DNDTSQYTQSLGAWHGFVAQQTMYAKKKYFGTTSKTYIYLSGWMVAALRSEFGPLPDQSM
HEKTSVPKLIAEIYTFLRQADAKVLNDYFRELNAAEEAGQDTSAILEKIENFDSHVVPII
ADIDAGFGNEEATYLLTKQMIEAGACAIQVENQVSDAKQCGHQAGKVTVPHEDFISKINA
IRYAFLELGVEDGVIVARTDSEGASLTQKIPVSNEPGDLASQYIDFIEMEEVTLENAKEN
DSLLKHNGKLVRPVRLPNGLYQFREDTNIDRVVLDCVTALENGADLLWIETPTPDVAHIK
MMVDRIKEQQPKAKLVYNNSPSFNWTLNFRKQIIAQWEEEGKDLSAYNKADLMSADYDGT
ELDTAADEAARNFQRDAAREAGVFHHLITLPTYHTTALSVHELAKGYFGEDGMLAYAAGV
QRKEIREGIACVKHQAMAGSDLGDDHKEIFSGENALKAGGGKNTMNQF
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactgcatataaatcagcgatcgatttagtacgtgaactaaaacagaaacacggt
aactggcagaacatcagcgaaactgatgcggcacgtatgatggcacaaaaccgcttcaaa
acaggtttagatattgctaagtacaccgcaaaaattatgcgtcaagacatggaagagtat
gacaatgacacgtctcaatacacccagtctctaggtgcatggcatggttttgttgcacag
caaaccatgtatgcgaagaaaaaatattttggcacaacatctaaaacttacatctaccta
tctggttggatggtagcagctctacgttctgagtttggtcctctgcctgaccaatctatg
cacgaaaaaacgtctgtacctaagctgattgcagagatctacactttcttgcgtcaagca
gatgcaaaagtattgaacgattatttccgcgagctaaacgctgctgaagaagcgggtcaa
gacacctcagctatcttagaaaaaatcgaaaactttgattcacatgttgtgccaatcatt
gcagatatcgatgcaggtttcggtaacgaagaagcaacgtatctattgaccaaacaaatg
attgaagcgggtgcttgtgccattcaggttgaaaaccaagtatctgatgccaagcaatgt
ggtcaccaagcgggtaaagttaccgtaccgcatgaagacttcatctctaaaataaacgcg
attcgttatgcattcttagagcttggtgttgaagacggtgttatcgttgctcgtactgac
tctgaaggcgcgtcattaacgcaaaaaatcccagtatcaaatgagccaggcgatcttgct
tctcagtacatcgattttatcgagatggaagaagtcacgctagaaaacgccaaagagaac
gacagcttacttaagcataacggcaaattagtacgtccagttcgtttgcctaacggttta
tatcagttccgtgaagacaccaacatcgatcgcgtggtccttgactgtgtaactgctcta
gaaaacggcgctgatctactatggatcgaaacaccgactccagacgtagcacacatcaaa
atgatggttgaccgtattaaagagcaacagccaaaagccaagcttgtatacaacaacagc
ccatcgttcaactggacgctgaacttccgtaagcaaatcatcgctcagtgggaagaagaa
ggtaaagacctatctgcctataataaagctgacttgatgagtgctgattacgatggtact
gagcttgatacagcagctgacgaagcggctagaaacttccaacgcgatgcagcacgtgaa
gcaggtgtattccatcacttaatcacgctacctacttatcacaccacggctcttagcgtt
catgaacttgctaaaggctacttcggtgaagatggtatgcttgcttatgcagctggcgta
caacgtaaagaaatccgtgaaggcatcgcttgtgttaaacaccaagcaatggcgggttct
gaccttggtgatgatcataaagagatcttctctggtgaaaacgcccttaaagctggcggc
ggcaagaacacgatgaaccagttctaa

DBGET integrated database retrieval system