KEGG   Psychrobacter cryohalolentis: Pcryo_1860Help
Entry
Pcryo_1860        CDS       T00350                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pcryo_1860
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pcryo_1860
Enzymes [BR:pcr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Pcryo_1860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2296421..2298007
Genome map
AA seq 528 aa AA seqDB search
MSTAYKSAIDLVRELKQKHGNWQNISETDAARMMAQNRFKTGLDIAKYTAKIMRQDMEEY
DNDTSQYTQSLGAWHGFVAQQTMYAKKKYFGTTSKTYIYLSGWMVAALRSEFGPLPDQSM
HEKTSVPKLIAEIYTFLRQADAKVLNDYFRELNAAEEAGQDTSAILEKIENFDSHVVPII
ADIDAGFGNEEATYLLTKQMIEAGACAIQVENQVSDAKQCGHQAGKVTVPHEDFISKINA
IRYAFLELGVEDGVIVARTDSEGASLTQKIPVSNEPGDLASQYIDFIEMEEVTLENAKEN
DSLLKHNGKLVRPVRLPNGLYQFREDTNIDRVVLDCVTALENGADLLWIETPTPDVAHIK
MMVDRIKEQQPKAKLVYNNSPSFNWTLNFRKQIIAQWEEEGKDLSAYNKADLMSADYDGT
ELDTAADEAARNFQRDAAREAGVFHHLITLPTYHTTALSVHELAKGYFGEDGMLAYAAGV
QRKEIREGIACVKHQAMAGSDLGDDHKEIFSGENALKAGGGKNTMNQF
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactgcatataaatcagcgatcgatttagtacgtgaactaaaacagaaacacggt
aactggcagaacatcagcgaaactgatgcggcacgtatgatggcacaaaaccgcttcaaa
acaggtttagatattgctaagtacaccgcaaaaattatgcgtcaagacatggaagagtat
gacaatgacacgtctcaatacacccagtctctaggtgcatggcatggttttgttgcacag
caaaccatgtatgcgaagaaaaaatattttggcacaacatctaaaacttacatctaccta
tctggttggatggtagcagctctacgttctgagtttggtcctctgcctgaccaatctatg
cacgaaaaaacgtctgtacctaagctgattgcagagatctacactttcttgcgtcaagca
gatgcaaaagtattgaacgattatttccgcgagctaaacgctgctgaagaagcgggtcaa
gacacctcagctatcttagaaaaaatcgaaaactttgattcacatgttgtgccaatcatt
gcagatatcgatgcaggtttcggtaacgaagaagcaacgtatctattgaccaaacaaatg
attgaagcgggtgcttgtgccattcaggttgaaaaccaagtatctgatgccaagcaatgt
ggtcaccaagcgggtaaagttaccgtaccgcatgaagacttcatctctaaaataaacgcg
attcgttatgcattcttagagcttggtgttgaagacggtgttatcgttgctcgtactgac
tctgaaggcgcgtcattaacgcaaaaaatcccagtatcaaatgagccaggcgatcttgct
tctcagtacatcgattttatcgagatggaagaagtcacgctagaaaacgccaaagagaac
gacagcttacttaagcataacggcaaattagtacgtccagttcgtttgcctaacggttta
tatcagttccgtgaagacaccaacatcgatcgcgtggtccttgactgtgtaactgctcta
gaaaacggcgctgatctactatggatcgaaacaccgactccagacgtagcacacatcaaa
atgatggttgaccgtattaaagagcaacagccaaaagccaagcttgtatacaacaacagc
ccatcgttcaactggacgctgaacttccgtaagcaaatcatcgctcagtgggaagaagaa
ggtaaagacctatctgcctataataaagctgacttgatgagtgctgattacgatggtact
gagcttgatacagcagctgacgaagcggctagaaacttccaacgcgatgcagcacgtgaa
gcaggtgtattccatcacttaatcacgctacctacttatcacaccacggctcttagcgtt
catgaacttgctaaaggctacttcggtgaagatggtatgcttgcttatgcagctggcgta
caacgtaaagaaatccgtgaaggcatcgcttgtgttaaacaccaagcaatggcgggttct
gaccttggtgatgatcataaagagatcttctctggtgaaaacgcccttaaagctggcggc
ggcaagaacacgatgaaccagttctaa

DBGET integrated database retrieval system