KEGG   Psychrobacter cryohalolentis: Pcryo_1878Help
Entry
Pcryo_1878        CDS       T00350                                 

Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pcryo_1878
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pcryo_1878
   00630 Glyoxylate and dicarboxylate metabolism
    Pcryo_1878
Enzymes [BR:pcr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Pcryo_1878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2319428..2321632)
Genome map
AA seq 734 aa AA seqDB search
MSQSSNANRVQKGILAIDQQLFDFIENEVLPKVGIDSDGYWSGFEKVIKEFTPRNKALLA
TRAKIQGQIDQWHLQHPTKNGDIDYPAYKAFLQEIGYLLPEGEAFSVSTENVDDEIARIA
GPQLVVPVRNARYALNANNARWGSLYDALYGTNVISDENGQEAKGGYNPTRGAAVVAYAK
KFLDENFALASGSYSDVTGFRVVDGKLEIAQGDSSTQLKDAAQFAGFVGDADSPSAVLLK
NNNLHAEIQVDGNHPIGKDDPAHIKDVLLESALTAIQDCEDSIAAVDAEEKVEAYRNWFG
LMNGDLQETFEKGGKTRTRKQNPDREYTTPEGDTLTLPGRSLLLLRNVGHLMQNPSILVD
LGNGQEEVFEGLMDGLITPLLSLNDLKGKTELSNSRKGSMYIVKPKMHGPDEVKMANDLF
NASEDLLGLERYTIKIGIMDEERRMTVNLKEAIRQAKERVIFINTGFLDRTGDEMHTSMN
AGPFVRKGDMKSQTWLPAYEQWNVDIGLEVGLQGHAQIGKGMWAKPDEMQEMMDTKIAHP
QAGANTAWVPSPTGATLHSMHYHKVNVAEVQDSLKSRARASVDDILTIPLAKNTNWTEEE
KQQEIDNNAQGILGYVVRWVNQGVGCSKVPDINDVGLMEDRATLRISSQHIANWLHHNVV
SEQQVMDAMKRMAKIVDEQNAGDADYQPMATDLDNSYAFKAACDLVFKGREQPSGYTEPL
LHQARLDLKASVGC
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtcttctaatgccaatcgtgttcaaaaaggcattcttgccattgatcagcag
ctgttcgattttatcgaaaatgaagtgctgccgaaagtcggtattgattcagacggttac
tggtcaggtttcgaaaaggtcatcaaagagtttacgccacgtaataaagcactgcttgca
acgcgtgctaagattcaaggacagattgaccaatggcacctgcaacatcctaccaaaaat
ggcgacattgattatccagcgtacaaagcatttttacaagaaattggctacctattacca
gaaggcgaagcgttcagtgtcagcacagaaaacgtcgatgatgagattgcccgtattgca
ggacctcagctggtagtaccagtacgtaatgctcgctatgcgttgaacgccaataatgcg
cgttggggcagcttatatgatgctttatatggcaccaatgttatcagtgatgaaaatggt
caagaagcaaaaggtggctacaatccaacacgtggcgcagccgtcgtcgcttatgccaaa
aaattcctagatgaaaattttgccttagcatcaggctcctatagcgatgtaacaggtttt
agagtcgttgatggtaagcttgaaattgcgcaaggcgatagcagcacgcaactaaaagat
gccgcacagtttgcaggtttcgtaggcgacgctgatagtcctagcgctgtgttattaaag
aacaataacttgcatgctgagattcaagttgatggcaatcatcccattggcaaagatgat
cctgcacatatcaaagacgtgttattagagtcggcgctgactgcgatacaagattgtgaa
gactccatcgctgctgttgatgcagaagagaaggttgaagcgtatcgcaattggtttggc
ttgatgaatggcgatttgcaagaaacctttgagaaaggcggcaagacccgtacgcgtaaa
cagaatcctgatcgcgaatatactacgccagagggtgatacgctgaccttgccaggtcgc
tcacttttattgctacgtaacgtcggacatctcatgcaaaatccatcgattttggtagat
ttaggcaatggtcaagaagaggttttcgaaggtttaatggatggtttgattacgccttta
ttatcattgaatgatttaaaaggtaaaaccgagctatcaaactcacgtaaaggttcaatg
tatattgttaaaccaaaaatgcatggtcctgatgaggtgaagatggcgaatgacttattt
aacgcctcagaagacctactgggcttagagcgttatacgataaagatcggcattatggat
gaagaacgccgtatgacggtcaacttaaaagaagccattcgccaagcaaaagagcgtgtt
attttcatcaataccggcttcttagatcgcacaggtgatgagatgcacaccagtatgaat
gcaggtccatttgtccgcaaaggcgatatgaagtcgcaaacgtggctgcctgcttatgag
caatggaacgtcgatatcggtcttgaagtaggcttacaaggtcacgcgcagattggtaaa
ggcatgtgggcaaaacctgatgaaatgcaagagatgatggacaccaaaattgcccatcca
caggcaggtgctaatacggcgtgggtgccatctccaacgggtgctaccttacacagcatg
cactatcataaagtcaatgttgctgaggttcaagacagcctgaaatcacgtgcgcgcgct
agcgtagatgatatcttaaccattccattggcaaaaaacaccaattggactgaagaagaa
aaacagcaagagattgataataatgctcaaggtatcctaggctatgtcgtacgttgggta
aaccaaggcgttggttgctctaaagtacctgacatcaatgacgtcggcttgatggaagat
cgtgcgacattgcgtatctcaagtcagcatattgccaattggttacaccataatgttgtc
agcgagcagcaagtgatggacgctatgaaacgtatggctaaaatcgtcgatgagcaaaac
gctggtgatgctgattatcaaccaatggcgactgacttggacaactcctatgctttcaaa
gccgcttgtgatttggtatttaaaggtcgcgagcagccaagtggttatactgagccatta
ttgcatcaagcacgtctagatctaaaagccagtgttggctgctaa

DBGET integrated database retrieval system