KEGG   Psychrobacter cryohalolentis: Pcryo_1946Help
Entry
Pcryo_1946        CDS       T00350                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Pcryo_1946
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Pcryo_1946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2400413..2400868)
Genome map
AA seq 151 aa AA seqDB search
MSIVNKYQLVGMLVAALLLSACEKTPPDYRATVTLPLYIEGDADNGALIYQDACGQCHQL
NPGLNKKGPQLMNIYGAPAAELADYTYSEGLKASGWVWDAQTLDTYIADAEKAMPDSKML
SDPMPDSKERADVIAYLSTLRAAAPSVENDK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagtcaataaatatcaactggtcggtatgcttgtcgccgctttgctgctaagt
gcttgtgagaaaacgccgcctgattaccgtgctactgttacgctaccgctttatattgaa
ggcgatgccgataatggtgcactcatatatcaagatgcttgtggtcagtgtcatcagtta
aaccccggtctcaataaaaaaggcccgcagctgatgaatatttatggcgcgccggcagcg
gaacttgcagattatacttatagtgaaggacttaaagcctcgggttgggtatgggatgct
caaacgcttgatacttatattgcggatgctgaaaaagccatgccagattctaaaatgctg
tcagacccgatgccagattctaaagagcgcgctgatgtgatcgcttacttgtctaccctt
cgcgcagctgccccaagtgttgaaaatgataaataa

DBGET integrated database retrieval system