KEGG   Psychrobacter cryohalolentis: Pcryo_2095Help
Entry
Pcryo_2095        CDS       T00350                                 

Definition
(GenBank) CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr02020  Two-component system
pcr02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Pcryo_2095
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Pcryo_2095
Enzymes [BR:pcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Pcryo_2095
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Pcryo_2095
Two-component system [BR:pcr02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Pcryo_2095
Bacterial motility proteins [BR:pcr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Pcryo_2095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Ribosomal_L1
Motif
Other DBs
NCBI-ProteinID: ABE75872
JGI: Pcryo2095
UniProt: Q1Q8Y1
Position
complement(2562411..2563421)
Genome map
AA seq 336 aa AA seqDB search
MGNIRALALKDKNEIKVLVVAEDHQQRMAFSDTVRSCGFHLVDCVTPSQLKDKFDGYESA
IDIWLIDSDYDEHLATMTAASNPVAMLVGFSQAPYLNEAQQYAKWQRKFKRKLAQLLDLP
NLIDNSVYKDDISDWRYVVFLGASMGGPSAVKEFLDHLSPTLPISILLAHHFNQTMISTL
PRILNRHNDWHCQMITSSQRMRTGQCLIVPIDQQIVCDSTGRIILLDQAWVGDYKPAIGQ
ILKNTSDVYGSELINIIFSGMGNDGTQYLDLIQDNDSQLWAQDPILSTCPSQPQAIIDSG
YCTFIGSPQALAEKLTNYIANKATNDTPHSFIVSDL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacatacgtgccttggcgttaaaagataaaaatgagattaaagtactggtggtg
gcagaagaccatcagcagcggatggcgttctctgatacagtgcggagctgtggctttcat
ctggtggattgcgttacaccatcgcagttgaaggataagtttgatggttatgaaagcgct
attgatatctggttgatagacagtgattacgatgagcatctagcgaccatgacagctgct
tccaatcctgtagcgatgttggtcgggtttagtcaagcaccttatcttaatgaggcgcag
cagtacgctaaatggcaacgtaaattcaaacgtaagcttgcgcaactgctggatttgcca
aatcttatcgataattctgtctataaggatgatattagtgattggcgttatgtggtgttc
ttaggggcatctatgggtggtcctagtgcggttaaagagttcttagatcacctatcgcca
acactgccgataagtattttactagcgcatcattttaatcaaaccatgattagtaccttg
ccacgtatattaaatcgccataatgactggcactgccagatgattacttcctcgcagcgc
atgcgtacaggtcaatgtctgatcgtacctatcgatcaacagattgtctgtgactcaact
ggtcgcattatcttattagatcaggcttgggtaggggattataaacctgctattggtcag
attctcaaaaacaccagcgatgtttatggtagcgagctgataaacattatcttttcaggt
atgggcaatgatggcacgcagtatttagatttgatacaagataatgacagtcaattatgg
gcacaagacccaattttgagtacttgtcccagtcagccacaggctatcattgactcagga
tattgtacctttatcggcagtcctcaagcattggcagaaaagctgaccaactatattgct
aataaagcgacaaacgacactccacattcatttattgtgagcgacttatga

DBGET integrated database retrieval system