KEGG   Psychrobacter cryohalolentis: Pcryo_2315Help
Entry
Pcryo_2315        CDS       T00350                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr00670  One carbon pool by folate
pcr00790  Folate biosynthesis
pcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pcryo_2315
   00670 One carbon pool by folate
    Pcryo_2315
Enzymes [BR:pcr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Pcryo_2315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ABE76092
JGI: Pcryo2315
UniProt: Q1Q8B1
Position
2842834..2843406
Genome map
AA seq 190 aa AA seqDB search
MSYANTEVAQIAAISSNRCIGKDNELPWHISADLQHFKSMTTKPNDGAIQGIVIMGRKTF
ESMGSKPLPKRVSFIISSQIDYAEQKGLVGSEKAYVMHNLDDALTQAASLAHGAHLDTIW
VIGGERVFSDALLYTDRIELTHVDTEIVDGDAFYPELPSEFEVAQESEQMHDEKSALDFR
FVTYKRKNAE
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgagttatgccaacaccgaagttgcccaaatcgcggctatcagtagcaatcgctgtatt
ggtaaagacaatgagctaccgtggcatatctcagccgatttgcagcattttaaaagtatg
acaaccaaaccaaatgacggtgcgatacagggtatcgtgattatgggtcgcaagaccttt
gagtcaatgggcagcaagccgttacctaaacgtgtgagctttattatcagtagccagata
gattatgctgagcaaaaaggcttggtaggtagtgaaaaagcttatgtaatgcataattta
gacgatgccttaacccaagcagcaagcctagcgcatggtgcgcatcttgatacgatttgg
gtaattggtggcgagcgcgtgtttagcgatgcattgctgtacaccgaccgtatcgaactc
actcacgtcgatactgaaatcgttgatggcgatgccttttatcctgagctgccaagtgag
tttgaagttgcgcaagaatctgagcaaatgcatgatgaaaaaagcgcgttagattttaga
tttgtgacttataaaagaaaaaacgctgaataa

DBGET integrated database retrieval system