KEGG   Psychrobacter cryohalolentis: Pcryo_2315Help
Entry
Pcryo_2315        CDS       T00350                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pcryo_2315
   00670 One carbon pool by folate
    Pcryo_2315
Enzymes [BR:pcr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Pcryo_2315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2842834..2843406
Genome map
AA seq 190 aa AA seqDB search
MSYANTEVAQIAAISSNRCIGKDNELPWHISADLQHFKSMTTKPNDGAIQGIVIMGRKTF
ESMGSKPLPKRVSFIISSQIDYAEQKGLVGSEKAYVMHNLDDALTQAASLAHGAHLDTIW
VIGGERVFSDALLYTDRIELTHVDTEIVDGDAFYPELPSEFEVAQESEQMHDEKSALDFR
FVTYKRKNAE
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgagttatgccaacaccgaagttgcccaaatcgcggctatcagtagcaatcgctgtatt
ggtaaagacaatgagctaccgtggcatatctcagccgatttgcagcattttaaaagtatg
acaaccaaaccaaatgacggtgcgatacagggtatcgtgattatgggtcgcaagaccttt
gagtcaatgggcagcaagccgttacctaaacgtgtgagctttattatcagtagccagata
gattatgctgagcaaaaaggcttggtaggtagtgaaaaagcttatgtaatgcataattta
gacgatgccttaacccaagcagcaagcctagcgcatggtgcgcatcttgatacgatttgg
gtaattggtggcgagcgcgtgtttagcgatgcattgctgtacaccgaccgtatcgaactc
actcacgtcgatactgaaatcgttgatggcgatgccttttatcctgagctgccaagtgag
tttgaagttgcgcaagaatctgagcaaatgcatgatgaaaaaagcgcgttagattttaga
tttgtgacttataaaagaaaaaacgctgaataa

DBGET integrated database retrieval system