KEGG   Psychrobacter cryohalolentis: Pcryo_2390Help
Entry
Pcryo_2390        CDS       T00350                                 

Definition
homoserine kinase
Orthology
K02204  
homoserine kinase type II [EC:2.7.1.39]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pcr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pcr00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2938664..2939833)
Genome map
AA seq 389 aa AA seqDB search
MSVYTQLTDDQFATFCQRFGVSFARAIPITQGIKNSNWFIQTTDDVDGAHSYVFTLFEER
PPEDIEKMAVILNQLDGKLPVAAPLSLVDSAEKCYVIRYDNKAITLVPCLAGSHPQQTTQ
AMCHEIGASLAVLHETLQQLQPAEEYGVPLYPWSEVRDREKQFMPADEAKLMSDIWQSYT
DLPLATLPKGLCHLDMFADNTLWNLSLNNSQKGEAHLTGLLDFTEVSVEHYVMDIAITIN
DFCTTWGMAEQGESVNFDRSKMAAFLQGYESKRMLGEDEKRALPVMLAKAAVIFWLLRLN
VIHYNRTEGRTGDNIMVKNPDLMKRLAAYHWSHVEKAQNTVFVLLAINNKIEKPIAGVFS
SITQAEQTCDSLGNSSDFIIKEYTLDQLV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtctatacccagttaaccgatgaccaatttgctaccttttgccaacgttttggc
gtatcgttcgcccgtgccattccgattacccaaggtatcaaaaactctaactggtttatt
cagacgactgacgatgtagatggcgcacattcttatgtgtttaccttgtttgaagagcgt
ccaccagaagacatcgaaaaaatggcggttatcttaaaccaattagatggtaaattgccg
gtagcggcgccattatcattggttgatagcgcagaaaaatgttatgtcatacgttatgac
aacaaagctattacgctagtgccatgtttggcaggctcgcatccacagcagacgacgcaa
gcgatgtgtcatgaaattggcgcgtctttggcagtattgcatgaaacgctacaacagcta
cagcctgcggaagaatatggcgtgcctttatatccatggagcgaggtacgcgaccgtgaa
aagcagtttatgccagctgatgaagccaagctgatgagtgatatttggcaatcttatacg
gacttgccacttgccactttgccaaaaggcttatgtcatttagacatgtttgctgataat
actttatggaacttatctttaaataacagtcaaaaaggtgaagcgcatctgactgggtta
ttagatttcaccgaagtcagcgttgaacattatgtgatggatattgccattacgattaat
gatttttgtaccacatggggtatggctgaacaaggcgagtcggtgaattttgaccgcagt
aaaatggcggcttttttgcaaggctatgagtcgaaacgcatgctcggtgaagatgaaaag
cgtgcactaccagtgatgctcgcaaaagctgcggtgattttttggctattacgtctcaac
gtcattcattataaccgtaccgaaggtcgtaccggtgataacatcatggtcaaaaaccct
gacttaatgaagcgtctagccgcttatcattggtcacatgttgaaaaagcacaaaatacg
gtatttgtactgttagctattaataataagatcgaaaagccgatagctggtgtgtttagc
agtattacgcaagctgagcaaacatgtgatagtttaggtaatagcagcgattttattatt
aaagaatatacgctcgatcaattagtataa

DBGET integrated database retrieval system