KEGG   Psychrobacter cryohalolentis: Pcryo_2434Help
Entry
Pcryo_2434        CDS       T00350                                 

Definition
G-D-S-L lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Pcryo_2434
Enzymes [BR:pcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Pcryo_2434
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Pcryo_2434
Lipid biosynthesis proteins [BR:pcr01004]
 Fatty acid synthase
  Component type
   Pcryo_2434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3007778..3008590
Genome map
AA seq 270 aa AA seqDB search
MMNRPFRLPQRLLTVVALTVAIAISGCQKTPDANEAQTDTGSQNSNKNTSQTSDIQVSQT
TSTTNPAEQPAPLTILALGDSLTEGLGVDNDDNYPAQLQTRLQELGYKDVKVINSGLSGE
TSTGLVNRLDWVLQTKPDITILTIGANDAIRGIDVATVEANIRTAVKRLQDNDSVVILGG
MQIYDNLGSDYVKSFAAIYPRVAKDMNVTLIPFFLDGVGGDPKLNQADAIHPTKEGYTLI
VNNNILPILQPELKKINPSNVTNTPTETAQ
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacagaccttttcgcttgccgcagcgcttgctcacggttgtcgcattgacggta
gcaatcgcaatcagtggttgccaaaaaacgcctgatgctaatgaagctcagacggatact
ggcagtcaaaacagcaataaaaataccagtcaaacctccgatatccaagtgtctcaaacc
acatctacaacgaaccctgctgaacaaccagcgcctttgaccatattggcattaggtgac
tcgttaaccgaagggcttggcgttgataatgatgacaattaccctgctcaattacaaaca
cgcttacaagaacttggttataaagatgtaaaagtcatcaattcaggattgagcggcgag
accagtaccggtttggtcaatcgcttggattgggtattacagaccaaacctgatatcact
attttgaccattggtgccaatgatgctattcgtggtattgatgtcgcgacggttgaagca
aatattcgtactgccgtaaaacgcttacaggacaatgacagcgtggttatcttgggcggt
atgcagatctatgacaaccttggctctgattatgtaaaatcttttgcagcgatatatcca
agagtggcgaaagacatgaacgtgacgcttattccgttctttttagacggtgttggcggc
gaccctaagctcaatcaagccgatgccattcatccgaccaaagaaggttatacgctgatc
gttaataacaatatcttgccgatattacagcctgagcttaaaaaaataaatccgtcgaat
gtgaccaatacgcctactgagacagcacaatga

DBGET integrated database retrieval system