KEGG   Psychrobacter cryohalolentis: Pcryo_2465Help
Entry
Pcryo_2465        CDS       T00350                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pcryo_2465
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pcryo_2465
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pcryo_2465
Enzymes [BR:pcr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pcryo_2465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3045616..3047037)
Genome map
AA seq 473 aa AA seqDB search
MKYISTRGQTAPMDFSDVLLMGLAPDGGLMLPEHYPNIDSATLTEWRALSYPQLAMAIMQ
RFATDIPATDLQDIIERTYTADIFGSDEIVPVRKLEDNIYILGLSNGPTLAFKDVAMQFL
GNAFEYVLKRKDARITIIGATSGDTGSAAEYALRGKENIEVFMLSPHGKMSEFQRAQMYS
LTDKNIHNIAIDGMFDDCQDIVKALQQDAEFKAAYNLGTVNSINWGRILAQIVYYFKAYF
AVTSSNDEKVSFSVPSGNFGNICAGHIAREMGLPVNRLIVATNENDVLNDFFNQGAYQPR
PTAKTYITSSPSMDISKASNFERFVYLLLDKDSARVHELFEGVKSGQGFDLSELMEAVNT
RYGFAAGKSTHNDRLQTIKALYEQHGELVDPHTADGIKVAKELQREGEVIVCAETALPVK
FADTIVEAIGQIDIARPAHTEGLESLPQHVVVLDNEAELVAEQIRQQVTPNPA
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatcagtacccgtggtcagacagcgccgatggattttagtgatgtgttatta
atgggtcttgcaccagacggtggtttgatgttgcctgagcattatccgaatattgatagt
gcgacgcttactgagtggcgcgcgctgagctatccacagcttgcgatggcgattatgcag
cgctttgcgactgatattcctgcgactgatttgcaggatattattgagcgcacttatacc
gctgatatatttggctctgatgagattgttcctgttcgcaagcttgaagataatatatat
attctaggcttatcaaacggtccgacattggcatttaaagatgttgctatgcagtttttg
ggcaatgctttcgaatatgtgcttaaaagaaaagacgcgcgtattactattattggtgca
accagtggcgatacgggcagtgcggcagaatatgcactacgcggcaaagagaatatcgaa
gtctttatgctttcaccgcacggcaaaatgagtgaattccagcgcgcgcagatgtatagc
ctgactgataaaaatatccataatattgccatcgacggtatgtttgatgattgccaagat
attgtcaaagcgctacaacaagatgcagaatttaaagcagcttataacttaggcacggtt
aactctattaactggggtcgtatcctagctcagattgtttactactttaaagcttacttt
gccgtgacttcaagtaacgacgaaaaagttagttttagtgtgccatcaggcaactttggt
aatatttgtgctggtcatattgcacgtgaaatggggctgccagttaatcgtctaatcgtc
gcaaccaacgaaaacgatgtactgaacgacttctttaatcaaggtgcttatcagccacgt
ccgactgccaaaacctatattacttcaagtccttcaatggatatctctaaagcctctaac
tttgagcgttttgtttatttgctattagataaagatagcgcgcgcgtccatgaactattt
gaaggtgtgaaatctggtcaaggtttcgatctatctgagctaatggaagcagttaatact
cgctatggtttcgctgcaggtaagtcaacccataatgaccgcctgcaaaccattaaagcg
ctttatgagcagcatggagagctggttgatccgcacaccgctgatggtatcaaagttgct
aaagaattacagcgcgaaggtgaagtgattgtttgtgctgaaacagcgttaccggttaag
tttgccgatacgattgttgaagcaataggtcaaatagatattgctcgtccagcccatacc
gaaggtttagagagcttaccgcaacatgtggtggtgcttgataatgaggctgagttggtt
gctgagcaaatccgtcaacaggtcacgccaaaccctgcctag

DBGET integrated database retrieval system