KEGG   Penicillium chrysogenum: Pc06g00840Help
Entry
Pc06g00840        CDS       T01091                                 

Definition
Pc06g00840
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
pcs  Penicillium chrysogenum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pc06g00840
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     Pc06g00840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 978 aa AA seqDB search
MVFKPFKSPLIRNPATSSTDTTSEPSRPTKKPRLGDEQASTDVQSTPIASRKPLQVSNRG
SDSTTQSSVSESTKDDTPDERYFNVLWRKPSAKKHKTWDGDGILSTRGECVYLRDIAGKE
MGRKVHEARLEPGTTLSISGKEVEIDSEMSRKEYLSGRMFLEGAKPASTSTSDPVPTPKK
EALPARKKGDVRKPTAAERTQSLKRSLALVTNPNANPGTAPATFAAYKAPLLSNTVTPKV
VGKVVPRHDPKAVGALVMPRPKSVPKGRQVVDVVVDPLLAKNLRPHQREGVKFLYECVMG
MRSFNGEGAILADDMGLGKTLQTIALLWTLLKQNPVFEAPPVIKKALIVCPVTLINNWRK
EFRKWLGNERIGVFVFDDKSKRLTDFTKGRAYSIMIVGYEKLRTVQEALANSSGVDIIIA
DEGHRLKTLQNKSGLAIQSLSAVKRVILSGTPIQNDLREFFAAVDLVNPGILGSFKSFIR
EFETPIVRSRQPEATSKDIEKGESRGEELRELTSQFMLRRTADILAKYLPPKTEYVLFCK
PTRPQANIYKAVLASPIFQSAMGNAESALQLITILKKLSNSPSLLTAKNNDDTPNETMTA
LIASIPQPLHRHLSPSSSAKIRVLDQLLDTMRSKTDEKIVLVSNYTSTLSLLATLLTSLG
LPYLRLDGSTPAQKRQGLVDDFNRLPASSCFAFLLSAKAGGTGLNLIGASRLILFDVDWN
PATDIQAMARIHRDGQKRPCRIYRILLKGSLEEKIWQRQVTKLGLADSVMQEKSSSNGGA
QFSVAELRDLFRLDEDRACQTHELLGCHCGGRGVQAGSEASSGAATPATVDGGGGSDIED
LSDPPSDLDDGDDDYDSDDSLPKPCTLVKASEVDMEKQEQSIRDGTSRAKMVGKGMKATK
KEGGTKSPKDKMHQSLAQYSHIDPTLLSGESDSNVAAGVEDDELEAAIDDDVLVSMLKDE
CNLVGYVFKKTNGAEIKS
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atggtcttcaaacctttcaaatcccctttaattaggaatcctgctacttcttccacagac
actaccagcgagcccagtcgtcctaccaaaaagccgcgcctcggagacgaacaagcatcc
acggatgtgcaatcaacaccaatagccagtcgaaagccgctccaagtcagcaatcgaggg
tcagacagtacgacacagtcatcagtcagtgaatcgaccaaagatgatacaccggatgaa
agatacttcaatgttctctggcgcaaaccaagcgccaaaaagcacaaaacatgggatgga
gacgggatcctctccactcgcggagaatgtgtatacctacgagacattgccgggaaggag
atgggacggaaggtgcacgaagcccgcctcgagccgggaacaacactgtctatctctggc
aaagaggtcgaaatagactctgaaatgtcgcgtaaagaatatctctccggcagaatgttc
ctggaaggcgcgaaaccagcatctacctctacgtcggacccagtgcccacaccgaagaaa
gaagctctccccgctcgaaagaagggtgacgtacgcaagcctacggctgctgagcggaca
caatccctcaagcgctcactggctctagttaccaaccccaatgcgaaccctggaacagca
ccggcgacatttgccgcgtataaagcgccgctgctttcgaataccgttactcccaaggtt
gtggggaaggtcgttccacgtcatgaccctaaggccgttggtgcgttggttatgccgcgg
ccgaagtctgtgccgaaagggagacaggttgtggatgtggtcgttgatcctctcttggcc
aagaacttgcggccgcatcagcgtgagggtgtgaagttcttatacgagtgtgtgatggga
atgcggtcgtttaatggcgaaggtgccattcttgcggatgacatgggtttgggaaagact
ttgcagactattgcactgctatggactttgcttaagcagaatcctgtctttgaagccccg
ccggttattaagaaggcactgattgtgtgtcctgtcactcttatcaataactggcggaag
gagttccgcaagtggctcggaaatgagcgcattggagtttttgttttcgatgacaagagc
aagcgtcttacggatttcactaagggccgggcctacagtattatgattgttggatatgag
aagctcagaaccgtccaggaagctttggctaatagttctggagttgatatcattatcgcg
gacgaaggccacaggctcaagacattgcagaacaagagtggcctagcgatccaatcgctc
agtgccgtgaagagagtcatcctctctggcacgccaattcaaaatgatctgagagagttc
tttgcagccgtggaccttgttaacccagggatacttggcagtttcaagtccttcattcga
gagttcgagaccccaatcgttcgcagcagacagccagaagcaacgagcaaggacatcgag
aaaggagagtccagaggcgaagagcttcgagaactcacctcgcaattcatgctccgccga
acagcagacatcttggccaaatacctccccccaaagaccgaatacgtcctcttctgcaaa
cccacccgtcctcaagcaaacatatacaaagctgtcctcgcctccccgatattccaaagc
gcaatgggcaacgccgaaagtgcgctgcagctgataacaatcctcaaaaagctcagcaac
agcccttccctcctaacagccaaaaacaacgacgacacccccaacgaaacaatgaccgcc
ctcatcgcctccatcccccaacctctccaccgccacctatccccctcctccagcgcaaaa
atccgcgttctcgaccaactcctcgacaccatgcgcagcaaaacagacgagaagatagtc
ctcgtctcaaactacacctcaaccctctccctcctcgcaaccctcctcacctccctaggc
ctcccctacctccgcctcgacggcagcacaccagcccagaaacgacaaggcctggtagac
gacttcaaccgtctcccagcaagctcctgcttcgccttccttctatccgcaaaagcgggc
ggaacaggtctcaacctgattggcgcaagccgccttatcctcttcgatgtagattggaac
ccggcaacggatatccaggccatggcgcgcatccaccgcgacggccagaaacgaccctgt
cgtatctaccgtatcctgctcaagggcagtctcgaggagaagatctggcagagacaggtt
accaagcttggtctggcggatagtgttatgcaggaaaagagtagcagtaatggtggggcg
cagttctcggtggctgagctgagggatttgttcagacttgatgaggacagggcttgtcag
acgcatgaattgttgggttgtcactgtggtggacggggtgtccaggctggttctgaggct
tcgtctggagctgcgacacctgctactgttgatggtgggggtgggtctgatatcgaggat
ttatcggatccgccttctgatcttgatgatggggatgacgattatgattcggatgactcg
ctgccgaaaccctgtactcttgttaaagcttccgaggtggatatggagaaacaagagcag
tctatccgtgacggcacttctcgtgctaagatggttgggaagggaatgaaggctacgaag
aaagagggcggtactaagagtccaaaagataagatgcaccagtctttggctcagtactca
cacattgacccaactctgctttctggtgaatccgattcaaatgttgcggctggggttgaa
gatgatgaacttgaggctgccattgatgacgatgtgctggtttctatgctgaaggatgag
tgtaacttggttgggtatgttttcaaaaagactaatggggcggaaataaagagttag

DBGET integrated database retrieval system