KEGG   Penicillium chrysogenum: Pc12g01520Help
Entry
Pc12g01520        CDS       T01091                                 

Definition
Pc12g01520
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pcs  Penicillium chrysogenum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 216 aa AA seqDB search
MVSFSSLFVAACAAVTAFALPNELEKRAITSNEQGTNNGYFYSFWTNGGGSVSYNNGAAG
QYSVNWKDCGSFTSGKGWATGSARNINFSGSFNPSGNAYLAVYGWTTSPLVEYYIMENYG
EYNPGSSMAHKGTVTSDGSVYDIYAHQQVNQPSIVGTATFNQYWSIRRNKRSSGTVTTAN
HFNAWSRLGMGLGSHNYQIVNTEGYQSSGSASITVS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggtctctttctcaagcctcttcgtggctgcctgtgcagctgtgactgcctttgcgctc
cctaatgagttggagaagcgggccatcacctcgaacgaacaaggaaccaacaatggttac
ttctattccttctggaccaacggtggtggcagtgtctcctacaacaacggtgctgcaggc
caatacagcgttaactggaaagactgcggatctttcacctccggcaagggctgggctact
ggcagcgcccggaacatcaacttctccggctctttcaacccctccggaaacgcttacctt
gctgtctacggatggaccactagccccctagttgagtattatatcatggagaactacggc
gaatacaaccccggcagcagcatggcccacaagggaaccgtgaccagcgatggatccgtc
tacgatatctacgcccaccagcaggtgaaccagccttccatcgtcggaactgccaccttc
aaccagtactggtccatccgccggaacaagcgcagcagcggaactgtcaccactgcaaac
cacttcaacgcttggtctaggcttggaatgggtctcggctcccacaactaccagattgtc
aacaccgagggttaccagagcagtggatctgcttccatcactgtttcctaa

DBGET integrated database retrieval system