KEGG   Penicillium chrysogenum: Pc12g05130Help
Entry
Pc12g05130        CDS       T01091                                 

Definition
Pc12g05130
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
pcs  Penicillium chrysogenum
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:pcs00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 744 aa AA seqDB search
MAGLDTAVSTGAKHESDLRRRNVPDTSKVHLDSNRMNDEDVKKARIQSPSFLHVLASWEP
IIAPIILTALALFTRLYQIGRSNIVTWDEAHFGKFGSHYLKREFYFDVHPPLGKMLVGLS
GYLAGYNGSFEFKSGEKYPEDVNYTFMRAFNAAFGIVCIPLAYYTARELNFRRATVWLIS
LMVLCENSYATISRFILLDSMLLCFTFTTTMCWARFHRLQRDSFSLEWYAWLCLTGLSIG
CVCSVKWVGFFCTALVGLYTIDDLWNKFGDLKMPRAVLAKHLVARVVGLIVIPILVYMFS
FYLHFLVLANSGPGDAQMSSLFQANLQGTEVGRDSPLELAIGSRVTLKNMGYGGGLLHSH
VQTYPEGSMQQQVTCYHHKDANNDWFIYPNRQEPDYDATADLRFVGDGDVIRLIHGQTGR
NLHSHAIPAPITKSHHEVSSYGNITIGDDKDHWKVEVVDDVASRDRSKIRTLTTAFRLRH
PVLGCYLRAGNVNLPQWGFKQIETTCTKENKPSDVYTHWNVESHTNERLPPGDPGSYKSP
FLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNVGLRMCSWDDSVVKYYLLGN
PLVYWGSTAALGGFGLLFLWYLLRWQRGYNDLSNEDIRHIHYSGLYPVIGWVLHYLPFII
MARVTYVHHYYPALYYAILNFGFCVDWVTRKMNPRLSAAVYAFLYVIIVGLFIHFRAIVF
GMEGSNQQWTHLRWLPGWKMANAN
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcctggacactgctgtgagcacgggcgccaaacatgagtctgacctccgtcga
agaaatgtccccgatactagcaaagttcatctggactcaaaccggatgaatgatgaagat
gtgaagaaagccagaatacagtcaccttcgttcctccatgtgctagctagctgggagccg
atcattgcccctatcatcttgactgcactcgccctcttcacccgcctgtaccagatcggc
cgttccaacattgtgacctgggatgaggcccacttcggtaaattcggttcccactatctg
aaacgcgagttctacttcgatgtccacccgcctttggggaagatgcttgttggcctgtcc
ggctatcttgctggctataacgggtcttttgaattcaagtctggcgagaagtatccagaa
gatgtgaactatacctttatgcgagccttcaatgctgcctttggtatagtctgcattccc
cttgcctactacactgcgcgagagttgaacttccgtcgggccacagtctggttgattagc
ctgatggtgctgtgtgagaactcctacgcaacaatttcccggtttatacttcttgactcg
atgctgctctgtttcacatttactaccacaatgtgctgggcaagattccaccggttgcaa
cgtgatagcttttcgctggaatggtatgcctggctctgtttgactggcttgagcattggc
tgtgtctgtagtgtcaaatgggtcggtttcttctgcactgctcttgtcggtctttatact
attgacgatctctggaacaaatttggcgacctgaagatgccacgggctgtgctcgcaaaa
cacctggttgctcgtgtcgtggggttgattgttatcccaatcttggtctacatgttttcc
ttttatctgcacttcttggtcctggcgaacagtggcccaggtgatgcccagatgagctcg
cttttccaggccaacctgcaaggtaccgaggttggtagagacagccctcttgagcttgca
attgggtcgcgtgtcacactcaaaaatatgggctacggaggagggcttctgcactctcat
gttcaaacctacccggagggatctatgcagcagcaggtcacctgctaccaccacaaagat
gccaacaacgactggtttatctatcccaaccgacaggagccggattatgatgccactgct
gatctgcggttcgttggtgatggcgatgtcatccggctgattcatgggcagacaggtcgc
aacctgcattcccacgctatcccagcaccaatcactaaatcacaccacgaggtgtcatct
tacggaaatattaccattggagatgacaaagaccactggaaagtggaggtggtcgacgat
gttgcatctcgggatcgatctaagatccggacactcacaacagcattccgactccgccat
ccagtcctaggctgctacctgcgggcaggaaatgtcaatctacctcaatggggcttcaag
cagattgaaacaacgtgtaccaaggaaaacaaacccagcgatgtgtacactcactggaat
gttgagtctcataccaacgagcgcctaccccctggtgatcctggctcctataaatcgccc
ttcttgaaggacttcatccacttgaatgtggccatgatgacctctaacaatgctctggtt
cctgatcctgacaagcaagatgacctggcttccaagttttggcaatggccgattctcaat
gtcggcttgcgcatgtgctcttgggatgatagcgttgttaaatactatctcctaggaaac
cccctggtctactggggaagtactgcggctcttggtggatttggtcttctattcctctgg
taccttctgcgctggcagaggggttacaatgatctcagcaacgaggatatccgtcacatc
cactactccggcttgtacccggttatcggatgggtcttgcactaccttcccttcataatc
atggctcgtgtgacttatgttcaccattactatccggctctctactatgccatcctgaac
ttcggcttctgcgtcgattgggtgacacggaagatgaatcccagattgtctgcggcggtg
tatgccttcctctacgtgatcattgtcggattgttcattcatttccgagcgattgtattt
gggatggagggttctaaccagcaatggactcacctacgctggctacccggatggaaaatg
gcgaatgcgaactaa

DBGET integrated database retrieval system