KEGG   Penicillium chrysogenum: Pc12g06860Help
Entry
Pc12g06860        CDS       T01091                                 

Definition
Pc12g06860
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pcs  Penicillium chrysogenum
Brite
Enzymes [BR:pcs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Pc12g06860
Transfer RNA biogenesis [BR:pcs03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Pc12g06860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 575 aa AA seqDB search
MATMTLTSQEIKRAAKKNAKNVPENERFMRACSDIANALIQDYESYRDSNKPKKDLNLNK
LRATFSRKHSLSSSPPLTAIIAAVPEHYKKYILPKLIAKPIRTSSGIAVVAVMCKPHRCP
HIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQIKALGH
SVDKVEYIIMGGTFMSLPEDYRDSFISQLHNALSGYQTDNVDEAVMAGEMSNVKCVGITI
ETRPDYCLDTHLSSMLRYGCTRLEIGVQSLYEDVARDTNRGHTVAAVAETFKLAKDAGFK
VVSHMMPDLPNVGMERDLFQFQEYFENPNFRTDGLKLYPTLVIRGTGLYELWRTGRYKNY
TPNALIDLVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTTCRD
VRTREVGINEVKNKIRPSQIELIRRDYTANGGWETFLAYEDPKQDILIGLLRLRKCTETH
TFRPEFTGQQTSIVRELHVYGSAVPLHGRDARKFQHRGFGTLLMEEAERIAREEHGSRKI
SVISGVGVRSYYARLGYFLDGPYMSKMLDPWEDEE
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggctactatgactttgacctcgcaggaaatcaaacgggctgccaagaagaatgcaaag
aatgtaccggagaacgagcgattcatgcgagcatgttctgatattgcaaatgctctcatt
caagattacgagtcatacagagactctaacaagcccaagaaggatctcaatcttaacaag
ttgcgggctaccttttcgaggaagcacagcttgtccagctcgccaccactgacagccatt
atcgcggcagtacctgagcactacaagaaatatatcctgccaaagctgattgcgaagccg
attcgaacctcctctggtatcgccgtagtggcggttatgtgtaaaccccatcgatgcccc
cacatcgcgtataccggtaacatctgtgtctattgccctggtggcccagactccgatttc
gaatactcaactcagtcatataccggatatgaaccgacctcgatgcgagcgatccgcgct
cgttacgatccgtttgagcaggcgcgaggacgtgtggaccagatcaaagctctcggtcac
agcgtggacaaggtggaatacattatcatgggcggaaccttcatgtcgttaccggaagat
tacagggacagcttcatctcccagcttcataatgcgctgagcggataccagacggacaac
gttgacgaggccgtgatggcaggcgaaatgagcaacgtgaagtgtgtgggtatcacaatt
gaaacccgaccagattactgtctggatacacatctaagcagcatgctccgatacggttgc
acgcggttggaaattggcgtgcagagtctgtacgaggatgttgcgcgagacaccaaccgc
ggtcacaccgtagcagcggtagctgagaccttcaagcttgccaaggatgccggtttcaag
gtcgttagccacatgatgcccgacctgccaaacgtcggaatggagcgcgatctgttccag
ttccaggagtacttcgagaaccccaacttccgtaccgacggtctcaaactctaccccaca
cttgtcatccgaggcaccggtctctacgaactgtggcgcaccggccgctataagaactac
acacccaacgctcttatcgaccttgtcgcacgcattctcgccctagttccgccatggacc
cgtatctaccgagtccagcgtgatatccccatgccacttgttacctccggtgtggagaac
ggcaacctgcgcgaactggcattggcgcgtatgaaggacttcggcacaacctgccgtgat
gtccgcacgcgagaagtcggtatcaatgaagtcaagaacaagatccgcccctcgcagatt
gagttgatccgccgtgactacactgccaatggcggctgggagactttcctggcatacgaa
gacccaaagcaggatattctcattggattgcttcgtctgcgcaagtgcactgagacccat
accttccggcctgagttcaccggccagcagacgagtatcgtccgcgagctccacgtctac
ggttctgccgttccacttcacgggcgtgatgcccgcaagttccagcaccgtggctttgga
accttgttgatggaggaggcggagcgtattgcccgcgaggagcacggtagtcgcaagatc
agtgttatctccggtgtgggcgtgcgtagctactatgctcgcctcgggtacttccttgat
ggtccttacatgtccaaaatgttggacccatgggaggacgaggagtga

DBGET integrated database retrieval system