KEGG   Penicillium chrysogenum: Pc12g07100Help
Entry
Pc12g07100        CDS       T01091                                 

Definition
Pc12g07100
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pcs  Penicillium chrysogenum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Pc12g07100
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pc12g07100
  Lipid metabolism
   00071 Fatty acid degradation
    Pc12g07100
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pc12g07100
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pc12g07100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 351 aa AA seqDB search
MSPIPETQWAQVVEKKGGPPVYKQIPVPKPGPDEVLVKMKYTGVCHTDLHAMNGDWPLTV
KQNLVGGHEGAGIVVAKGSLAQGIEIGDHAGIKWLNGSCLACEFCKTADEPLCPDAQLSG
YTVDGTFQQYAIGKAAHVAKLPKEVSLDAIAPILCAGITVYKGLKESGARPGQTVAIVGA
GGGLGSLAQQYAKAMGLRVIAIDGGEEKKAMCEKLGAEAYVDFTKSTDLVADVKAATPDG
LGAHAVLLLAVSEKPFQQAVEYARSRGTIVAIGLPAHAFLKAPVFETVVKMISIKGSYVG
NRQDGVEAIDFYARGLIKAPFKTVPLKELPEVFKLMEEGKIAGRYVLEIPE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtccccaatcccagagacccaatgggcacaagtcgtcgaaaagaaaggcggtccaccc
gtgtacaaacaaatccccgtcccaaagcccggtcccgacgaagtcctcgtgaagatgaaa
tacaccggcgtctgccacacagacctgcacgccatgaacggcgactggcctctgactgta
aagcagaacctagtcggcggccacgaaggcgccggcattgtcgtcgcgaagggctctctc
gcgcagggtattgagatcggcgaccacgcaggcattaaatggctcaacgggtcctgtctc
gcatgcgagttctgtaagacagctgacgagccgctgtgtcccgatgcgcagctgtccgga
tacaccgtcgacggcacgttccagcagtacgcgattggtaaggcggcgcatgtggctaag
ttgcctaaggaggtgtcgcttgatgctattgcgcctattctgtgtgctggtattacggtc
tacaagggtcttaaggagtctggtgcgcgtcctggtcagacggtggctattgttggtgct
ggtggtggtcttggttcgcttgcgcagcagtatgctaaggctatggggttgcgtgttatt
gctattgatggtggcgaggagaagaaggctatgtgtgagaagcttggtgctgaggcttac
gtcgacttcaccaagtctaccgacctcgttgcagatgtcaaggctgctacccccgatggc
ctgggtgctcacgccgtactcttgcttgctgtctctgagaagccgttccagcaggctgtt
gaatatgctcgctcccgtggtactattgttgccattggccttcccgcccatgcattcctc
aaggcccctgttttcgaaaccgttgtcaagatgattagcatcaagggtagctatgtcggt
aatcgccaggatggtgttgaggccattgacttctacgcgcgtggcttgatcaaggctcct
ttcaagactgttcctctgaaggagctgcctgaggtgttcaagctcatggaggaaggcaag
atcgctggccgctatgtcctagagattcctgaatag

DBGET integrated database retrieval system