KEGG   Penicillium chrysogenum: Pc12g07280Help
Entry
Pc12g07280        CDS       T01091                                 

Definition
Pc12g07280
Orthology
K08738  
cytochrome c
Organism
pcs  Penicillium chrysogenum
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Pc12g07280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 132 aa AA seqDB search
MREAERAEAALVEEAKKEADRIANLSSSPGDAAKGAKLFQTRCAQCHTVEAGGAHKVGPN
LHGLFGRKTGSSEGYAYTDANKQAGVEWNQDTLFSYLENPKKFIPGTKMAFGGLKKTKER
NDLITYLKESTA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaggccgagcgtgcagaagccgccctcgttgaggaagccaaaaaagaagccgac
aggatcgctaacctcagctcctctccaggcgacgccgccaagggtgccaagctcttccag
acccgttgcgcccagtgccacaccgttgaggccggcggtgcccacaaggtcggccccaac
cttcacggtctcttcggccgtaagactggttcctccgagggctacgcctacaccgacgcc
aacaagcaggccggtgttgagtggaaccaggacactctgttctcctacctcgagaacccc
aagaagttcattcccggtaccaagatggccttcggtggtctcaagaagaccaaggagcgc
aacgacctcatcacctacctcaaggaaagcaccgcataa

DBGET integrated database retrieval system