KEGG   Penicillium chrysogenum: Pc12g08170Help
Entry
Pc12g08170        CDS       T01091                                 

Definition
Pc12g08170
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pcs  Penicillium chrysogenum
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pcs00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 352 aa AA seqDB search
MSYQQERYIAELAVQRACLLTQKVFFEKAKGTVSKDDKSPVTIGDFGAQALIISAIRKNF
PNDEIVAEEEASSLREDKDLSAEIWRLVKDIKLDDAESDNILGGPLTSEESMLDIIDNGN
SAGGPKGRIWALDPIDGTKGFLRGGQYAVCLGLMVDGDVKVGAIGTPNLPVDDAAPIDAS
TGAQQSAAAGNGVLFSAILGEGATSRPLSGGTLAASKPISMRPVSKISDAVFCEGVEAAH
SAQGDNAAVAQLLGITAPSVRLDSQAKYCSIARGAGDVYLRLPVKKDYQEKIWDHAAGDL
IVREAGGQVTDIYGNRLDFSKGRTLAVNKGVVAAPKAHQDQVIDAVKTVLKL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcttaccaacaggaacgttacattgccgaattggccgtccagagggcgtgcctcctg
acacagaaggtcttcttcgagaaggccaagggcacagtctccaaggacgacaagtcccct
gtcaccattggcgacttcggcgcccaggccctcatcatctcagccatccgcaagaacttc
cccaatgacgagatcgtcgccgaggaggaggctagctccctacgtgaagacaaggacctc
agcgccgagatctggcgcctggtcaaggacatcaagctggatgatgcggagagcgataac
attctgggtggcccgctcaccagcgaggagagcatgctggacatcattgataatggcaac
agtgccggtggtccaaagggccgcatctgggccctcgatcccatcgacggcactaagggt
ttcctccgtggtggccagtacgctgtgtgccttggcctgatggttgacggcgacgtcaag
gtcggtgctatcggtactcctaacctccccgtcgacgatgctgcccccattgatgccagc
accggcgcccagcagtccgcggctgccggaaacggtgttctcttctccgctattctgggt
gagggtgccaccagccgtcccctgagcggtggtactcttgctgccagcaagcccatctct
atgcgtcccgtctccaaaatctccgacgctgtcttctgtgaaggtgttgaggctgcgcac
tccgcccagggcgacaacgctgccgttgctcagcttcttggcatcaccgccccgagtgtg
cgactggactcgcaggcgaagtactgctccattgcccgcggtgctggcgacgtctacctg
cgtctccccgtcaagaaggactaccaggagaagatctgggatcacgctgctggtgacttg
attgtgcgcgaggctggtggccaggtgactgacatctacggcaaccgcttggatttcagc
aagggccggaccttggctgtcaacaagggtgtcgttgctgctcccaaggctcaccaggac
caggtcattgatgccgtcaagaccgttctgaagctgtaa

DBGET integrated database retrieval system