KEGG   Penicillium chrysogenum: Pc12g09530Help
Entry
Pc12g09530        CDS       T01091                                 

Definition
Pc12g09530
Orthology
K17842  
torulene dioxygenase [EC:1.13.11.59]
Organism
pcs  Penicillium chrysogenum
Pathway
Carotenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    Pc12g09530
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.59  torulene dioxygenase
     Pc12g09530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 560 aa AA seqDB search
MSSIGRDSTARENGMSGDHYNNWPNDKGFDPEYEQRDPVELSVVGQIPAYAAGILYRTGP
GKSQLEVDNGETLRLSHWFDGFGQTHRFQIFAPENSHASPRVFYNSRFSTDDLIEHARKT
GSLDEISFGQKRDPCKSVLGKVQTEYLPQPTPSSSNISVTLSINVPGLDPRPDELASRWG
DSQGIRTLYAKTDYNAFKKLDPETLEPIGMASQIILHPELSGQRSASHARSDPITGDMFN
YNLTLGSTCTYRVFGVSASTGKTTILATFPATPAYLHSLLITEDHVVLCVWNAHINPQLL
DSSFMDSILPTDPSQPAVWYVIDRKHGKGLIAIYESPAFFCFHTVNAWLEPSKENPAEMD
IVADIVRTDNSKFLEYVYYENLISSLDTAKTFQKKRDDSFRTSFTRFRLPAVPSTPCTDP
KKAVIEWSLCKSLSPELPTMNPKRVTQKHRYAYAVTFRGEATLTDGIMKLDCDTQQVQLW
ACHGQSPGEPIFVANPEGTSEDDGVLLSVVLDGMRGKSYLLCLDARNLSELGRANVDGAV
GFGFHGQHVPTVGGMPTGDY
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctattggccgagactcaacagccagagagaatggtatgagcggagatcattat
aacaactggcccaacgacaagggtttcgatcctgaatacgaacagcgtgaccccgtcgag
ctctctgtggtaggacagattcctgcttacgctgctggaatcctgtatcgaacaggtcca
ggcaaaagtcagcttgaagttgataatggagaaacactacgactctctcactggttcgac
ggatttggtcaaacccaccgtttccagatcttcgcaccagagaactcccatgcttcaccc
cgggttttctacaactctcgcttttctaccgacgaccttatcgaacatgcaagaaagacg
ggatctctggacgagatcagtttcggacagaaacgcgatccttgcaagagcgtcctggga
aaagtccagactgaatatctcccgcagccgactccgtcgagtagcaacataagtgtcact
ctttcaattaacgtcccgggcctcgatcccaggcccgatgagttggcttctcgctggggt
gattcccagggaatccggactctctatgcgaagaccgactacaatgccttcaagaagctc
gatccagaaaccctggagcccatcggcatggcctcgcagattattctgcaccctgaactt
tcgggacaacgctctgcatctcatgcccgatctgatcctattaccggagacatgttcaac
tataatctcaccctaggatcaacctgtacataccgtgttttcggggtctcggcttcaacg
gggaagacgacaatcctagcgaccttccccgcaacaccagcttatctccactcccttctc
atcaccgaggaccatgttgtgctgtgtgtgtggaacgcacatatcaatccacagctgttg
gactcctcgttcatggattcaatattgccaacagacccaagtcagccggcagtctggtat
gtcattgaccgtaagcacggcaaggggttgatcgcaatatacgaaagccctgcatttttt
tgcttccacacggttaacgcatggctcgagccctcaaaggagaatccggcggagatggat
atcgttgcagatattgtcagaaccgacaactctaaattcttggaatacgtctattacgag
aacttgatctcttcgttggatacagccaagaccttccaaaagaagagagatgattctttc
cgaacatcctttacccggttccgcctacctgccgtgccttccacgccatgcaccgatcct
aagaaagcagtaatcgagtggtccctttgcaaatcgttgtcgcctgagctgccaactatg
aatccgaaaagagtcactcagaaacaccgatatgcctacgctgtgaccttccgtggagaa
gcaactctgacggacggtatcatgaagctggattgtgatacccagcaagtccagctctgg
gcatgtcatggccaatcgcccggtgagcccattttcgtggctaaccccgagggcactagt
gaggatgatggtgtacttcttagcgtggttctcgatgggatgcgtggcaagagttatttg
ctctgtcttgatgctcgtaacttgtcggagcttggccgagcgaatgtcgatggagctgtt
gggtttggattccatggacagcatgttccgactgtgggtggaatgcctacaggtgactac
taa

DBGET integrated database retrieval system