KEGG   Penicillium chrysogenum: Pc12g09530Help
Entry
Pc12g09530        CDS       T01091                                 

Definition
Pc12g09530
Orthology
K17842  
torulene dioxygenase [EC:1.13.11.59]
Organism
pcs  Penicillium chrysogenum
Pathway
Carotenoid biosynthesis
Class
Metabolism; Metabolism of terpenoids and polyketides; Carotenoid biosynthesis [PATH:pcs00906]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 560 aa AA seqDB search
MSSIGRDSTARENGMSGDHYNNWPNDKGFDPEYEQRDPVELSVVGQIPAYAAGILYRTGP
GKSQLEVDNGETLRLSHWFDGFGQTHRFQIFAPENSHASPRVFYNSRFSTDDLIEHARKT
GSLDEISFGQKRDPCKSVLGKVQTEYLPQPTPSSSNISVTLSINVPGLDPRPDELASRWG
DSQGIRTLYAKTDYNAFKKLDPETLEPIGMASQIILHPELSGQRSASHARSDPITGDMFN
YNLTLGSTCTYRVFGVSASTGKTTILATFPATPAYLHSLLITEDHVVLCVWNAHINPQLL
DSSFMDSILPTDPSQPAVWYVIDRKHGKGLIAIYESPAFFCFHTVNAWLEPSKENPAEMD
IVADIVRTDNSKFLEYVYYENLISSLDTAKTFQKKRDDSFRTSFTRFRLPAVPSTPCTDP
KKAVIEWSLCKSLSPELPTMNPKRVTQKHRYAYAVTFRGEATLTDGIMKLDCDTQQVQLW
ACHGQSPGEPIFVANPEGTSEDDGVLLSVVLDGMRGKSYLLCLDARNLSELGRANVDGAV
GFGFHGQHVPTVGGMPTGDY
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctattggccgagactcaacagccagagagaatggtatgagcggagatcattat
aacaactggcccaacgacaagggtttcgatcctgaatacgaacagcgtgaccccgtcgag
ctctctgtggtaggacagattcctgcttacgctgctggaatcctgtatcgaacaggtcca
ggcaaaagtcagcttgaagttgataatggagaaacactacgactctctcactggttcgac
ggatttggtcaaacccaccgtttccagatcttcgcaccagagaactcccatgcttcaccc
cgggttttctacaactctcgcttttctaccgacgaccttatcgaacatgcaagaaagacg
ggatctctggacgagatcagtttcggacagaaacgcgatccttgcaagagcgtcctggga
aaagtccagactgaatatctcccgcagccgactccgtcgagtagcaacataagtgtcact
ctttcaattaacgtcccgggcctcgatcccaggcccgatgagttggcttctcgctggggt
gattcccagggaatccggactctctatgcgaagaccgactacaatgccttcaagaagctc
gatccagaaaccctggagcccatcggcatggcctcgcagattattctgcaccctgaactt
tcgggacaacgctctgcatctcatgcccgatctgatcctattaccggagacatgttcaac
tataatctcaccctaggatcaacctgtacataccgtgttttcggggtctcggcttcaacg
gggaagacgacaatcctagcgaccttccccgcaacaccagcttatctccactcccttctc
atcaccgaggaccatgttgtgctgtgtgtgtggaacgcacatatcaatccacagctgttg
gactcctcgttcatggattcaatattgccaacagacccaagtcagccggcagtctggtat
gtcattgaccgtaagcacggcaaggggttgatcgcaatatacgaaagccctgcatttttt
tgcttccacacggttaacgcatggctcgagccctcaaaggagaatccggcggagatggat
atcgttgcagatattgtcagaaccgacaactctaaattcttggaatacgtctattacgag
aacttgatctcttcgttggatacagccaagaccttccaaaagaagagagatgattctttc
cgaacatcctttacccggttccgcctacctgccgtgccttccacgccatgcaccgatcct
aagaaagcagtaatcgagtggtccctttgcaaatcgttgtcgcctgagctgccaactatg
aatccgaaaagagtcactcagaaacaccgatatgcctacgctgtgaccttccgtggagaa
gcaactctgacggacggtatcatgaagctggattgtgatacccagcaagtccagctctgg
gcatgtcatggccaatcgcccggtgagcccattttcgtggctaaccccgagggcactagt
gaggatgatggtgtacttcttagcgtggttctcgatgggatgcgtggcaagagttatttg
ctctgtcttgatgctcgtaacttgtcggagcttggccgagcgaatgtcgatggagctgtt
gggtttggattccatggacagcatgttccgactgtgggtggaatgcctacaggtgactac
taa

DBGET integrated database retrieval system