KEGG   Penicillium chrysogenum: Pc12g10840Help
Entry
Pc12g10840        CDS       T01091                                 

Definition
Pc12g10840
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
pcs  Penicillium chrysogenum
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Pc12g10840
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Pc12g10840
Peptidases [BR:pcs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Pc12g10840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1091 aa AA seqDB search
MSSDAATLPSPPKMPPGKDSRRPYSVGDDMNSSGKVNGPDSYPKAKTPLIPPRRPRFPNI
KDLQDQAAALNVNDTTPLNILLPTAADAIEKARSLADDDYNDKAYVQYLRASEITINLIP
HHPDYRTASQRPDWYKEFADLLKAVRSKQGTMDAIKRDIIEDNLVSGMQPTGIFTSRSPE
QPPATPLGRENRESGTNFARMPSPTQYQRMPEAEAHSQSFSSPPDDMLAQRFAKLKASSS
PPSNQYGLGASAAGPGSPIVGSAGQTPLHPSNVPLGAYSSPPPRRPLGPRSMGSSSNVPT
IPPKLPLNTSLPRAPDPAYSPVFTVPSKPTSNPPRRSTESTRSGNLRYSQFSNSPRVSPT
RGGLDDNPYRSLTPNGLNSARETRSNSPDLPYSTTITAQSLLENLRKFNVLLIDVRTRDQ
YDNGHVYAKSIICIEPVILKENVSAEELEERLVISPEHEQALFEKRNEYDLVVYYDQSAD
SVSYLAGSPVGTSAPHLRALHDTLYEFNAYKPLKAGRPPALLLGGLDAWIDLLGQQSLAT
SSTAAVMSSLQARKPVPRPGRPLGRVPTMASANSSLEIRKRRLREFTPLNSKELSEWMEK
SKVEEIDPSTYAEEDALTEEPEETEPEPPGPFVQTYEAFLRRFPEPHDVPQSMTQVDSRP
PPAAAPNYAAHMSVAPSRPPPAVPRPSYSGVSDGRQIQPHLQRQNSANRTALYAPSSRLD
RIKLPRTGLTNFGVTCYMNSTIQCLSATIPLSRFFIDNRFRYYVQKNWKGSQGVMPGLYA
NLTRSLWKNDIEVIMPTSFRNFCGRLNREWAIDRQQDAKEFFDFVVDCLHEDLNINWQRT
PLRPLTFSEEMQRERMPMTKVSRIEWDRYCHREESFISSLFAGQHASRLRCTTCHQTSTT
YEAFYSISVEIPPTGAGDIYQCLRSYCKEEMLSGDEVWKCPHCKCKRMATKQIIITRAPQ
ILVVHFKRFSASKTQSARKIHTPIEFPLHGLRMDDFVISHPPPPPPEPGMPPTTGATVPP
FTYDAFAVLRHLGSSMGSGHYISLVRDAERQCWRKFDDDRVTDFNPRELRTRDRLQNEQA
YIVFYERVPAK
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgatgcggcgactttgccatctcccccaaaaatgccaccggggaaggacagc
cggcgtccttactcggtgggggatgacatgaattccagcggaaaagtcaacggaccggat
tcctatcccaaggccaagacccctctcatcccaccgcggcgacctcggttcccaaatatt
aaagacctgcaagaccaggctgctgcgttaaatgttaacgatactacaccgcttaatatt
ctcttgccaacggccgccgatgcaatcgaaaaggccaggagccttgcagatgacgactac
aacgacaaagcctacgtccagtaccttcgcgcctccgaaattactatcaatctgatcccc
catcatccagattatcgaaccgccagccaacgccctgattggtacaaggagtttgccgat
ctattgaaggcggtgcggtccaaacaaggcactatggatgcgatcaagcgggacatcatc
gaggataatttggtcagtggcatgcagccaaccggtatctttacatccagatccccagaa
caacccccggccacgccactgggccgtgagaatcgagagtctggaacaaacttcgctaga
atgccaagtccgactcagtatcaaagaatgcccgaggcagaggcacattcgcaaagtttt
tccagtcctccagatgacatgcttgcgcaacgttttgccaaactcaaggcgtcttcttct
ccgccttctaaccagtatgggttgggagcaagtgctgctgggccgggaagcccgattgta
ggatctgcagggcagaccccacttcatccgtcgaacgtacccctgggggcatacagctcc
ccaccgccaagacggccattgggacctcgcagcatgggatcttcatctaatgtgccgacc
atcccaccgaagcttccgcttaacacgtcgttaccacgtgccccggacccggcctatagc
cctgtcttcaccgtgccatcaaagcccacttcaaacccacctagacggtcaaccgagagc
acacgctcaggcaatctaagatactcacaattcagcaactcgccacgtgtcagtccaacc
cggggaggcttggatgacaatccgtatagatctctcacgcccaatgggttgaattcggcg
cgagagacgcgaagcaactcgcccgatttgccgtacagcacaactataactgcacagagc
ctccttgaaaatctgcggaaattcaatgtgttgctgatcgatgttcgaacccgagaccag
tatgataacggtcacgtatatgcaaagtctattatttgcatagaacctgtgattctgaaa
gagaatgtgtcagcggaagaactagaggagcgactcgttatttcaccggagcatgagcag
gccttatttgagaaacggaacgagtacgaccttgtggtttactatgaccaaagcgccgat
tcagtcagctatcttgctggctcgccagtggggacatcggcaccccatctgcgggctctt
cacgatacactttacgagttcaatgcatacaagccgttgaaggctgggcggcctccggct
ctcctgcttggtggactggatgcctggatcgatcttttagggcagcaatcccttgcaaca
tcctcaaccgccgccgtcatgagttctctgcaggccagaaagcccgtgcctagacctggt
cggcccctcgggagagtgcccaccatggctagtgcgaattcaagccttgaaattcgaaag
agacgactacgcgagttcactcctttgaattcgaaggaattgtccgagtggatggagaaa
tctaaagtcgaggagattgacccgagcacctacgctgaggaagatgcgctgacggaggaa
cctgaggagacggaaccagagcctccaggtccatttgttcagacatatgaggctttcttg
cgtcgtttccctgaaccgcacgatgttccacagtccatgacacaggtggattcccgccct
ccccctgccgcagctccgaattatgctgcacacatgtcagtggccccctctcgaccaccc
cctgctgtgcctcgtcccagctatagtggcgtctccgacggacgacagatccagcctcat
ttgcaacgacagaattctgcgaatcggacggccttgtacgccccaagctctcgcctagat
cgcatcaaacttccgcggactggattgaccaatttcggtgtgacgtgctacatgaattcc
accatacaatgcctcagtgcaacaatcccactaagtaggttcttcatcgataaccgattt
cgctattatgtacaaaagaattggaaggggtctcagggcgttatgccgggactttatgcg
aacttgacccggtcgctatggaagaacgatattgaggtcatcatgccgacctcgttccgg
aacttctgtggacgcttgaatcgagaatgggccattgaccggcagcaagatgccaaagaa
ttcttcgattttgtggtagattgcctccacgaggatctcaatatcaactggcagcgaacg
ccgcttcgacctttgaccttttcggaggagatgcaacgagagcgaatgccaatgaccaag
gtttcccggattgaatgggaccgctattgccaccgcgaggagtcttttatctcgtcacta
ttcgcgggacaacatgctagccgattgcgttgcacgacctgccaccaaacctccactacc
tacgaggccttctacagtatcagcgttgaaattccacccacaggtgccggtgatatctat
caatgtctccgtagctactgcaaggaggagatgctgagcggcgacgaggtctggaagtgc
ccacactgtaaatgcaagcgaatggcaaccaagcagatcatcatcacgcgagcgccccag
attctagttgtccacttcaagcgcttttctgcatccaagacccaaagcgcacggaagatc
cacacccccatcgaattcccgcttcacggtctacggatggacgattttgtgatttctcac
cctccccctccccctccggagcccggcatgccgcccaccaccggcgccacggtcccaccg
tttacctacgatgcctttgctgtgttgcggcatcttgggtcttcgatgggcagcggacac
tacatctcattggtccgcgatgcggagcggcagtgctggcggaagttcgatgacgatcgg
gtcacggatttcaatccgcgggagcttcggacgcgggaccggttacagaacgagcaggcg
tacattgtgttttatgaacgagttccagcgaaatga

DBGET integrated database retrieval system