KEGG   Penicillium chrysogenum: Pc12g12740Help
Entry
Pc12g12740        CDS       T01091                                 

Definition
Pc12g12740
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pcs  Penicillium chrysogenum
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pc12g12740
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Pc12g12740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 304 aa AA seqDB search
MSLANIGTALAPSALLIAGVYAIKPEFVTYAIAAAGVLAGYLVFSNKPRKVLNPTEFQNF
VLKEKTEISHNVAIYRFALPRSTDILGLPIGQHISLAATIEGQPKEVVRSYTPISSDNEA
GYFDLLIKAYPQGNISKYLTELKIGDNMKVRGPKGAMVYTPNMCRHIGMISGGTGITPML
QVIKAIIRNRPRNGGNDTTKVDLIFANVNPEDILLKDQLEELEKEDDGFRVYYVLNNPPE
GWTGGVGFVTPDMIKERLPAPAADVKILLCGPPPMVSAMKKATEALGYTKARPVSKLEDQ
VFCF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcgccaacatcggcacggccctcgcgccctcggccctgctcatcgcgggtgtt
tacgccattaagcccgagtttgtcacctatgcaatcgctgccgctggagttctggccggt
tacttggttttcagcaacaaacctcgcaaggtcttgaaccccactgaattccagaacttc
gtcctcaaggagaagactgagatctctcacaatgtcgccatctaccgttttgccctccct
cgttccaccgatatcctcggtctccccatcggtcagcacatctctctcgccgctacgatt
gaaggtcagcccaaggaggttgtccgctcttacacccccatctcctccgacaacgaggct
ggctacttcgatctgctcatcaaggcctacccccagggtaacatctccaagtatcttacc
gaactgaagattggcgacaacatgaaggtccgcggccccaagggcgccatggtgtacact
cccaacatgtgccgtcacattggtatgatctccggtggcactggtatcacccccatgctg
caggttatcaaggccatcatccgcaaccgtcctcgcaatggtggtaacgacaccaccaag
gttgacctgatcttcgccaacgtcaaccccgaggacatcttgctcaaggaccagctcgag
gagctggagaaggaggacgatggattccgtgtctactacgttctcaacaacccgcccgag
ggttggaccggcggtgtcggcttcgtgactcccgacatgatcaaggagcgtctgcccgcc
cccgctgccgatgttaagattctcctctgtggccctcctcccatggtcagcgccatgaag
aaggccaccgaggctcttggatacaccaaggcgcgccccgtcagcaagctggaggaccag
gtcttctgcttctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system