KEGG   Penicillium chrysogenum: Pc12g12880Help
Entry
Pc12g12880        CDS       T01091                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
pcs  Penicillium chrysogenum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1388 aa AA seqDB search
MWIALDFLPVEFVHILNPLVLPPKGSKGAALIPFSIFPWLPRAATRGAQLIATTSSPKRR
KVSPEPRTSPGLRARRHGRSEHHSRHTSSSSSRGQSSSSSPPRYVPAHLQFQSGSPPGRS
LTPATATAGLSLSSDHSDMPSDTREGTPPTHGRSPSPGEKRPASEITDSDPEGGVSTVPN
NTRTYIIPRTCDGTSDESTNPTTLSNGKTESVPSADEQSRPASPKSDDTPTIDEQVAEVN
ALMTAPLKEGQKGFVVSMAWLKKVLARTAAHADHTDKGSLEGDIGPVNNLNIMLDTDPAT
PNFKDETGETFVPMRPGLHDALDFAIIPQHGWDLIQKWYGLADQSPVIIRYAHNISQPGD
TENIQYETYPPIFTIFKLANPAAGTTPTILRQTVKQSVKILASRQTNYQKWLKDAKEQAG
IEMSTKVRVWKILQLPSSTAASATATPAVSRSQSPAPPLALISNPNDKLLFDLNTFLDLP
EGSHRVLLENVKDQTQNANYNGRMTLDMAGLSVTNCVILEEQVGGSRGGEWVSEASAKTL
KSLGIPVDQPKTDAATKASAAKVALKSPQPSGRSTPTLPPDPIRGLISRGRKGKQLIVGL
QNLGNTCYMNSALQCVRSIEELSYYFLSGLYKPELNPTNVLGCGGTIAKQWANLLQELYK
SDPQPRSVNPYRFRTAAGRQREDFAGYEQHDSQEFVMFLLDALSEDLSRIVGSKPATVIP
DSTDEMIHDRKALEEFGKKCWDLYEARNASIITDLFAGMYKSTLICHNCEKTSIIMDPFT
MVTVPIPRGPMLINRTIIFYPLDGPPVSLKVRLDENDTLKVWKDFVAGKMGIDGDQIFAA
ETLHNSFWQTFCDDDDTFGSLRIGQEDTIVFFDLGPLPEPANSADSTSDDDAVLVPVFHR
KLVPRKNKEATRELFGIPSFIRLSSEESQDLEAIYRKLLNQANNMTTHDLLAAEENRNDD
NATDDSDTVVTNEDDARSADSRIKTTSVDGEDSIVDISMQAEQAPKPAEDTDESDSDSES
VKSPQHPLAGKIPARLLSLFDVTVMSTNATLPDGRNISTTKNYPSISSRIPSTPTSTKES
DDASSKNSADDNVDDDVDTDESDVTPNSARSLLHQGDAILLDWTPDAFDSLFGGKPHDSE
EIRGRPTYMNIRNVFDHTMTVSQKKPKQANFSLGQCLDEFSKEEILSQADSWFCPQCKTH
VSATKKFELWRTPDIMVVQLKRFSQFRGRNGHKISTVIDFPFEGLDLSSRVEGPTGGKSV
VYDLIAVDNHVGSMLGGHYTAFIKDFVTGAWVYCNDTSAKTVTNLQTIITSGAYLLFYRR
RSDRALGNQELRELVERYRNQEASDSGSSSGSRSPGGSQSPSEDGGRVLGGAPRRGSSAL
AGAGVAPR
NT seq 4164 nt NT seq  +upstreamnt  +downstreamnt
atgtggatagccctggattttctgccagtcgaattcgttcacatcctaaatccccttgta
cttccaccaaaaggaagtaagggtgctgctttgatcccattttccattttcccctggttg
ccccgagctgcgacacgaggtgcgcagctcatcgccacgacgtcttcaccaaagagacga
aaagtttccccagagcctcgcaccagtccaggccttcgggctcgacgtcacggccgctcc
gaacatcactctcgccacacatcttcctcttcttcccgcggccagagttcgtcgtcgtcc
ccgcctcgctacgtgcctgcgcatctgcagtttcagtccggaagcccgcctggccgctcg
ctcacccccgcgaccgcgaccgccggactctccctctccagcgaccattccgatatgccc
tccgatactcgagagggtacacctccaactcatggacgatccccttctcccggcgagaag
cgcccggcatccgagattacggactccgacccggaaggaggtgtgagcactgtccctaat
aacacgcgcacatacatcattccccgcacatgcgacggcaccagcgatgaatccacgaat
cccaccactttgagcaatggcaagacagaatccgtaccctcagccgatgagcagtccaga
ccagcatcgcccaaatcagatgatactcctacaatcgacgagcaggtggcggaggtgaat
gcgctgatgaccgcgccgctgaaagaaggacaaaagggctttgttgtttccatggcttgg
ctgaagaaggtgcttgcacgcactgcggctcatgcggaccacactgacaaaggatcattg
gagggcgacattggtcccgtcaacaacctgaacataatgctcgacaccgacccagcgacg
cccaacttcaaagacgaaaccggtgaaacctttgtgcccatgcgccccggtttgcatgat
gctctggatttcgccataatcccgcaacatggctgggacctgatccagaaatggtacggc
cttgctgaccagtcacctgtgatcattcgctacgctcacaacatcagccaacctggcgat
actgaaaacatccaatatgagacttaccctccaattttcaccattttcaaattggccaac
cccgccgcgggtaccaccccgacaatcttgagacaaaccgtcaagcagtctgtcaagatc
ctggccagtcgccaaacaaattaccaaaaatggttgaaggatgccaaagaacaggctggt
atcgagatgtccaccaaggttcgagtttggaagattcttcagcttcctagtagcaccgct
gcatcagccacggccaccccagctgtctctcgcagtcagtcgccagctcctccgttggct
ctgatctcgaaccccaatgacaagctccttttcgatctgaacactttcctcgatcttcca
gagggaagtcaccgggtgttgcttgaaaatgtcaaggatcagacccaaaacgcaaactac
aacggtcgtatgaccttggatatggctggtctcagtgtgacgaattgtgttattcttgag
gaacaggttggcggctccagaggtggagaatgggtgtccgaagcctctgccaaaactctg
aagagtctgggtatccctgtggatcagcccaagaccgatgctgctaccaaagcatctgcc
gctaaagtcgcactgaagagcccacaaccgagtggcagatctacccctaccttgccaccc
gatccaattaggggactcatctctcgtggtcggaagggcaaacagcttatcgtgggattg
cagaatcttggcaacacttgttacatgaactctgcgttgcaatgtgtgcgaagcattgag
gagttgtcttattacttcctgagtggattgtacaaaccagagttgaaccctaccaatgtc
cttggatgcggcggcaccattgccaagcaatgggccaacttgcttcaggagctctacaaa
tcggaccctcagccaagatctgtcaacccctatcggttccgtactgccgctggtcggcaa
cgtgaagactttgctggctacgaacaacatgacagccaggaatttgtcatgttcctcctt
gacgcactgtcggaagatctaagccgcattgttggcagcaagccagccactgtcatccct
gattccactgatgagatgattcacgatcgcaaggctcttgaggaattcggaaagaagtgc
tgggatctctacgaggcccgcaacgcctccattatcaccgacctgtttgccggaatgtac
aagtcaacactgatttgccacaattgtgagaagaccagcatcatcatggaccctttcaca
atggtcactgtgcccatcccaaggggtccgatgctcatcaatcgaaccattatcttctat
cctcttgacggcccacccgtatctctcaaagttcggcttgatgagaacgataccttgaag
gtctggaaggacttcgttgccggaaagatgggaattgatggggaccaaatctttgcagca
gaaacattgcacaattccttctggcaaaccttctgcgacgatgacgatacttttggcagt
ctacgcattggacaagaagacactattgtgttctttgatcttggtcctcttccagaacct
gctaattccgctgactctacttcggacgatgatgcagtccttgtacccgtcttccaccgc
aaacttgtcccgcgcaagaacaaagaggccactcgtgaacttttcggaatcccctccttc
atacgtctttctagtgaagaaagtcaagatcttgaggcgatttaccgcaagctcctgaac
caggccaataatatgactacacacgaccttctggctgccgaagagaacagaaacgacgac
aacgcaactgatgactctgacactgtggttacgaacgaggatgatgcgcgatcagcggat
tcccgaatcaaaacgacgtctgttgacggcgaagacagcatcgtcgacatttccatgcaa
gccgagcaagcgcccaagcctgcagaggacaccgacgagtcggattccgactctgaatct
gtcaagtctccccagcatcctcttgctggcaagattcccgccagactgctgtcactcttt
gatgtaacggtcatgagcacaaatgccactctgcctgatggacgcaacatctctacgacc
aagaactacccctccatttcctctcgcatcccatctactcccacttctactaaggaatcc
gatgatgcttcctccaaaaactccgcagatgacaatgtcgatgatgacgtcgatacagat
gaatcagatgtgacaccgaactcggcacgatcgctccttcaccaaggtgacgccatattg
cttgactggacccctgatgcctttgattcgcttttcggcggcaagccccatgactctgag
gagatccgtggtcgccctacctacatgaacatcaggaatgtctttgatcacaccatgacg
gtaagccagaagaagccaaagcaagcaaatttctctctcggccaatgcctggacgagttc
agcaaggaggaaattctttctcaggcagatagctggttctgtcctcagtgcaagacccac
gtttcagccaccaagaagtttgagctgtggagaaccccggatattatggtcgtccaactc
aagcggtttagccaattccgcggcagaaacgggcacaagatcagcactgtcatcgacttc
ccctttgagggactggatctgagcagccgagtggaaggccccacgggtggaaagagtgtg
gtgtacgatttgattgccgtcgacaaccacgtgggttcaatgcttggcggtcactacact
gccttcatcaaggactttgtgactggtgcctgggtctactgcaacgatacgtctgcgaag
actgttacaaacttgcagacgatcatcacgtcgggtgcctacctcctgttctaccgccgt
cgctccgatcgtgcattgggcaaccaggagctgcgggagctggttgaaagataccggaac
caggaggccagtgattctggcagttcttccggctcccgcagccccggtggttcccaatca
ccttcggaggacggcggtcgtgtcctcggcggcgcaccccgcagggggtcgtctgccttg
gccggggcaggggtggcaccccga

DBGET integrated database retrieval system