KEGG   Penicillium chrysogenum: Pc12g13440Help
Entry
Pc12g13440        CDS       T01091                                 

Definition
Pc12g13440
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pcs  Penicillium chrysogenum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:pcs01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pcs00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pcs00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:pcs00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 367 aa AA seqDB search
MGSVMEYSQIEIPTHCKAGVVVNEGPGFHVEVQMVPVPQPGPDDVLIKLNYTGLCSSDIH
MMQGDLGLPFMSAFGVRSPGHEGAGVVVKVGANVKTFKLGDRAGIKPMMDTCGSCALCWD
DKETYCKGAILTGLMTAGTYQQYLVSPARYASPIPDGVPDEIAGPIMCSASTIYRSLSES
NLRSGAWVVFPGGGGGVGIQGVQLAKAMGMRPIVVDTGESKQKLALDMGAEVFVDFKEVA
DPTKAVIEIADGVGAHGVFVTAPAAYKTAVSFIGDRIGGIVMCIGLPVAGSMMIGADPCL
YIFKNLTIKGTLVGSRSDTAMALDFARRGALRQISQVYPLNRMPEAVEKLRKGEVAGRIV
VNFNWEE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgggttcagttatggaatattctcaaatcgagattcccacgcactgtaaagcgggagtg
gtggtcaacgaaggtccaggtttccatgtcgaggtacagatggtgcctgttccacaacca
ggccccgacgatgttttgatcaagctgaactacaccggactttgctcgtccgacatccat
atgatgcaaggagacctgggtctccccttcatgtcggcgttcggtgtgcgctctccggga
catgaaggtgcgggtgtagtggtcaaagtcggagccaatgtgaagactttcaagttaggc
gatagagccggaatcaaacccatgatggatacatgcggatcctgtgcgctttgctgggat
gacaaggagacatactgcaagggcgcaattctcactggtctgatgacggcaggtacttac
cagcaatacttggtatcaccggcacgatatgcatcgccaatcccggatggggtccccgat
gaaatcgccggcccaattatgtgcagtgccagcactatctacagatctctgagtgaatct
aacctccgatcgggggcttgggttgttttccctggcggcgggggtggtgtggggattcaa
ggtgtgcagctggctaaagcaatgggaatgcgtccgatcgtggtggacacgggagaatcc
aaacagaaattggcactcgatatgggggcagaggtcttcgtggatttcaaagaagttgcc
gaccccacgaaagctgtgattgagattgcggatggggtcggggctcatggggtttttgtg
acagcccctgctgcttataaaacagcagtttcattcatcggagaccgtatcggaggcatt
gttatgtgcattggtcttcctgttgcagggtcgatgatgataggagccgatccctgtctg
tacatcttcaaaaatctgaccatcaagggcacccttgtcggtagccggagtgatactgcc
atggcgttggatttcgcacgacgaggggcactacggcaaattagtcaagtgtatccgttg
aaccgcatgcccgaggctgtggagaaacttcggaagggggaggttgccggaagaattgtg
gtcaatttcaactgggaggagtag

DBGET integrated database retrieval system