KEGG   Penicillium rubens: Pc12g13440Help
Entry
Pc12g13440        CDS       T01091                                 

Definition
(RefSeq) Pc12g13440
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pcs  Penicillium rubens
Pathway
pcs00010  Glycolysis / Gluconeogenesis
pcs00071  Fatty acid degradation
pcs00350  Tyrosine metabolism
pcs01100  Metabolic pathways
pcs01110  Biosynthesis of secondary metabolites
pcs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pc12g13440
  Lipid metabolism
   00071 Fatty acid degradation
    Pc12g13440
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pc12g13440
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pc12g13440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 8317467
NCBI-ProteinID: XP_002558152
UniProt: B6GZU3
AA seq 367 aa AA seqDB search
MGSVMEYSQIEIPTHCKAGVVVNEGPGFHVEVQMVPVPQPGPDDVLIKLNYTGLCSSDIH
MMQGDLGLPFMSAFGVRSPGHEGAGVVVKVGANVKTFKLGDRAGIKPMMDTCGSCALCWD
DKETYCKGAILTGLMTAGTYQQYLVSPARYASPIPDGVPDEIAGPIMCSASTIYRSLSES
NLRSGAWVVFPGGGGGVGIQGVQLAKAMGMRPIVVDTGESKQKLALDMGAEVFVDFKEVA
DPTKAVIEIADGVGAHGVFVTAPAAYKTAVSFIGDRIGGIVMCIGLPVAGSMMIGADPCL
YIFKNLTIKGTLVGSRSDTAMALDFARRGALRQISQVYPLNRMPEAVEKLRKGEVAGRIV
VNFNWEE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgggttcagttatggaatattctcaaatcgagattcccacgcactgtaaagcgggagtg
gtggtcaacgaaggtccaggtttccatgtcgaggtacagatggtgcctgttccacaacca
ggccccgacgatgttttgatcaagctgaactacaccggactttgctcgtccgacatccat
atgatgcaaggagacctgggtctccccttcatgtcggcgttcggtgtgcgctctccggga
catgaaggtgcgggtgtagtggtcaaagtcggagccaatgtgaagactttcaagttaggc
gatagagccggaatcaaacccatgatggatacatgcggatcctgtgcgctttgctgggat
gacaaggagacatactgcaagggcgcaattctcactggtctgatgacggcaggtacttac
cagcaatacttggtatcaccggcacgatatgcatcgccaatcccggatggggtccccgat
gaaatcgccggcccaattatgtgcagtgccagcactatctacagatctctgagtgaatct
aacctccgatcgggggcttgggttgttttccctggcggcgggggtggtgtggggattcaa
ggtgtgcagctggctaaagcaatgggaatgcgtccgatcgtggtggacacgggagaatcc
aaacagaaattggcactcgatatgggggcagaggtcttcgtggatttcaaagaagttgcc
gaccccacgaaagctgtgattgagattgcggatggggtcggggctcatggggtttttgtg
acagcccctgctgcttataaaacagcagtttcattcatcggagaccgtatcggaggcatt
gttatgtgcattggtcttcctgttgcagggtcgatgatgataggagccgatccctgtctg
tacatcttcaaaaatctgaccatcaagggcacccttgtcggtagccggagtgatactgcc
atggcgttggatttcgcacgacgaggggcactacggcaaattagtcaagtgtatccgttg
aaccgcatgcccgaggctgtggagaaacttcggaagggggaggttgccggaagaattgtg
gtcaatttcaactgggaggagtag

DBGET integrated database retrieval system