KEGG   Penicillium chrysogenum: Pc12g13500Help
Entry
Pc12g13500        CDS       T01091                                 

Definition
Pc12g13500
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pcs  Penicillium chrysogenum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pc12g13500
   01230 Biosynthesis of amino acids
    Pc12g13500
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pc12g13500
   00030 Pentose phosphate pathway
    Pc12g13500
   00051 Fructose and mannose metabolism
    Pc12g13500
   00052 Galactose metabolism
    Pc12g13500
  Energy metabolism
   00680 Methane metabolism
    Pc12g13500
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Pc12g13500
Enzymes [BR:pcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pc12g13500
Protein phosphatases and associated proteins [BR:pcs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Pc12g13500
Messenger RNA biogenesis [BR:pcs03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Pc12g13500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 782 aa AA seqDB search
MEPTKIAAQPAKRRRIGVLTSGGDAPGMNGAVRAVVRMAIHCDCEAYAIFEGYEGLVNGG
NMIRQLHWEDVRGWLSRGGTLIGSARSLAFRERVGRMKAAKNMVLRGIDALVVCGGDGSL
TGADVFRAEWPGLLADLIASGELSPEQVEPYKVLNIVGLVGSIDNDMSGTDATIGCYSSL
TRICDAVDDVFDTAFSHQRGFVIEVMGRHCGWLALMSAISTGADWMFLPEMPPRDGWEDD
MCSVITKNRTERGKRRTIVIVAEGAQDRQLNKVSSSKIKDILTDRLGLDTRVTILGHTQR
GGAACAYDRWLSTLQGVEAVRAVLEMSPESPSPVITIRENKIMRTPLMEAVQATKDVTAK
IDKKEFDEAMTLRDPEFREYYNAYLTTATQDDPKMVLPEGKRMRIAIIHVGAPAGGMNQA
TRAAVAYCLTRGHTPLAIHNGFPGLCRHHNDKPVSSVREVTWLEADSWVNEGGSDIGTNR
SLPSADMAETAKCFELYKFDALFVVGGFEAFTAVSELRQARAQYDAFKIPLIVLPATISN
NVPGTEYSLGSDTCLNTLIDFCDAIRQSASSSRRRVFVIETQGGKSGYIATTAGLAVGAV
AVYIPEEGVDIKMLSRDIDFLRENFIRDKGANRAGKIILRNECASGTYTTQVIADMIKEE
AKGRFESRAAVPGHFQQGGKPSPMDRVRALRMAIRCMQHIEGYAGKSGDEIAADPTSSAV
IGVKGSRVLFSPMGGESGLEATETDWARRRPKSEFWLELQDVVNVLSGRSHANNSSWSYE
ST
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggagcccacaaaaatcgccgctcagccggctaagagacgccgcattggtgtcctcacc
tctggtggagatgctcccggtatgaacggtgccgtgcgggctgttgtccgtatggcaatt
cactgcgactgcgaagcctacgccattttcgaaggatacgaagggctggtcaatggcggc
aacatgatccgccagctgcactgggaggatgtacgcggctggttgtcccgcggtggcacc
ctgatcggttctgcccgcagcttggcattccgtgagcgtgttggccgtatgaaggcagcg
aagaacatggtccttagaggtatcgatgctctagtcgtctgtggtggtgacggcagtttg
actggtgccgatgtcttccgtgccgagtggcccggcctgttggcagacctcattgcctcg
ggggagttgtcccctgagcaggtggaaccctacaaggtgttgaacattgtaggccttgtt
gggtcgattgacaacgatatgtctgggacagatgccactatcggttgttactcgtccttg
acccgtatctgtgatgccgtcgacgatgtctttgatactgctttctcccatcagcgtggt
ttcgtcattgaggtcatgggccggcactgtggatggcttgccttaatgtccgccatcagt
actggtgcggactggatgttccttcctgaaatgccccctagggacggttgggaggatgat
atgtgctccgtaatcaccaagaaccgaaccgaacgcggaaagcgccgtacgatcgttatt
gtcgccgagggagcccaggatcgccaattgaacaaggtctcgagctcgaaaatcaaggat
attctcacagatcgtctgggattggacacccgagtcacgattctaggccacacccaacga
ggtggcgcggcatgcgcttatgaccgctggctgtcgactctccagggtgtggaggccgtt
cgtgctgtgctagaaatgtcacctgagtctccttcaccagttatcaccatccgcgagaac
aagatcatgcgcacccctctgatggaagcagttcaagcaacaaaagatgtgacggcgaag
atcgacaaaaaggaattcgacgaggccatgacgctccgggatcctgaattcagggagtac
tacaacgcatatttgaccaccgcgacccaggatgacccgaagatggttcttccggaaggc
aagagaatgcgaatcgctattattcacgtcggtgccccagctggtggtatgaaccaagca
acccgtgccgccgttgcatactgcctaacccgtggccacaccccgctggctattcataac
ggtttccccggattgtgccgtcaccacaacgataagccagtcagctcagtccgcgaggtc
acttggctggaagctgatagctgggtcaacgagggtggttcagacattggaactaaccgt
agcctgccctcagctgatatggcggaaaccgccaaatgctttgagctgtacaagtttgat
gccctgtttgttgttggtggtttcgaggctttcacagccgtcagtgagctgcgccaggct
cgtgcgcagtatgatgcgttcaagattccgctcatcgtgctcccagctactatttccaat
aacgtcccgggcactgaatattccttgggcagtgacacctgcctgaacaccctgatcgac
ttctgtgatgccattcgtcaatctgcctcctcttctcgccgccgagtgttcgtgattgag
acccaaggtggcaaatctggatacatcgcaaccacagctggcctcgccgtgggtgccgtg
gctgtgtacattcctgaagagggtgttgatatcaagatgctctcgcgcgatatcgacttc
ctgcgtgagaacttcatccgcgacaaaggagctaaccgtgcaggcaagatcattctgcgt
aacgaatgtgcgtccggcacatacactacccaggtgatcgccgacatgatcaaggaagag
gcaaagggccgcttcgagtctcgcgccgctgttcccggtcacttccagcaaggtggaaag
ccttcgccaatggatcgtgttcgtgctttgcgtatggccatcaggtgcatgcagcacatc
gaaggatatgccggcaagagtggtgatgaaattgccgcggatcctacctccagtgccgtg
attggcgtcaaaggctcacgtgtgctattctcccccatgggtggtgagtctggtctggaa
gctaccgagactgattgggcgcgccgtcgccccaagtccgagttctggcttgaactgcag
gacgtcgtgaacgtcctgtctggacgcagccacgctaacaactcgagctggtcctatgag
agtacgtaa

DBGET integrated database retrieval system