KEGG   Penicillium rubens: Pc12g13500Help
Entry
Pc12g13500        CDS       T01091                                 

Definition
(RefSeq) Pc12g13500
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pcs  Penicillium rubens
Pathway
pcs00010  Glycolysis / Gluconeogenesis
pcs00030  Pentose phosphate pathway
pcs00051  Fructose and mannose metabolism
pcs00052  Galactose metabolism
pcs00680  Methane metabolism
pcs01100  Metabolic pathways
pcs01110  Biosynthesis of secondary metabolites
pcs01130  Biosynthesis of antibiotics
pcs01200  Carbon metabolism
pcs01230  Biosynthesis of amino acids
pcs03018  RNA degradation
Module
pcs_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pc12g13500
   00030 Pentose phosphate pathway
    Pc12g13500
   00051 Fructose and mannose metabolism
    Pc12g13500
   00052 Galactose metabolism
    Pc12g13500
  Energy metabolism
   00680 Methane metabolism
    Pc12g13500
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Pc12g13500
Enzymes [BR:pcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pc12g13500
Protein phosphatases and associated proteins [BR:pcs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Pc12g13500
Messenger RNA biogenesis [BR:pcs03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Pc12g13500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 8317473
NCBI-ProteinID: XP_002558158
UniProt: B6GZU9
AA seq 782 aa AA seqDB search
MEPTKIAAQPAKRRRIGVLTSGGDAPGMNGAVRAVVRMAIHCDCEAYAIFEGYEGLVNGG
NMIRQLHWEDVRGWLSRGGTLIGSARSLAFRERVGRMKAAKNMVLRGIDALVVCGGDGSL
TGADVFRAEWPGLLADLIASGELSPEQVEPYKVLNIVGLVGSIDNDMSGTDATIGCYSSL
TRICDAVDDVFDTAFSHQRGFVIEVMGRHCGWLALMSAISTGADWMFLPEMPPRDGWEDD
MCSVITKNRTERGKRRTIVIVAEGAQDRQLNKVSSSKIKDILTDRLGLDTRVTILGHTQR
GGAACAYDRWLSTLQGVEAVRAVLEMSPESPSPVITIRENKIMRTPLMEAVQATKDVTAK
IDKKEFDEAMTLRDPEFREYYNAYLTTATQDDPKMVLPEGKRMRIAIIHVGAPAGGMNQA
TRAAVAYCLTRGHTPLAIHNGFPGLCRHHNDKPVSSVREVTWLEADSWVNEGGSDIGTNR
SLPSADMAETAKCFELYKFDALFVVGGFEAFTAVSELRQARAQYDAFKIPLIVLPATISN
NVPGTEYSLGSDTCLNTLIDFCDAIRQSASSSRRRVFVIETQGGKSGYIATTAGLAVGAV
AVYIPEEGVDIKMLSRDIDFLRENFIRDKGANRAGKIILRNECASGTYTTQVIADMIKEE
AKGRFESRAAVPGHFQQGGKPSPMDRVRALRMAIRCMQHIEGYAGKSGDEIAADPTSSAV
IGVKGSRVLFSPMGGESGLEATETDWARRRPKSEFWLELQDVVNVLSGRSHANNSSWSYE
ST
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggagcccacaaaaatcgccgctcagccggctaagagacgccgcattggtgtcctcacc
tctggtggagatgctcccggtatgaacggtgccgtgcgggctgttgtccgtatggcaatt
cactgcgactgcgaagcctacgccattttcgaaggatacgaagggctggtcaatggcggc
aacatgatccgccagctgcactgggaggatgtacgcggctggttgtcccgcggtggcacc
ctgatcggttctgcccgcagcttggcattccgtgagcgtgttggccgtatgaaggcagcg
aagaacatggtccttagaggtatcgatgctctagtcgtctgtggtggtgacggcagtttg
actggtgccgatgtcttccgtgccgagtggcccggcctgttggcagacctcattgcctcg
ggggagttgtcccctgagcaggtggaaccctacaaggtgttgaacattgtaggccttgtt
gggtcgattgacaacgatatgtctgggacagatgccactatcggttgttactcgtccttg
acccgtatctgtgatgccgtcgacgatgtctttgatactgctttctcccatcagcgtggt
ttcgtcattgaggtcatgggccggcactgtggatggcttgccttaatgtccgccatcagt
actggtgcggactggatgttccttcctgaaatgccccctagggacggttgggaggatgat
atgtgctccgtaatcaccaagaaccgaaccgaacgcggaaagcgccgtacgatcgttatt
gtcgccgagggagcccaggatcgccaattgaacaaggtctcgagctcgaaaatcaaggat
attctcacagatcgtctgggattggacacccgagtcacgattctaggccacacccaacga
ggtggcgcggcatgcgcttatgaccgctggctgtcgactctccagggtgtggaggccgtt
cgtgctgtgctagaaatgtcacctgagtctccttcaccagttatcaccatccgcgagaac
aagatcatgcgcacccctctgatggaagcagttcaagcaacaaaagatgtgacggcgaag
atcgacaaaaaggaattcgacgaggccatgacgctccgggatcctgaattcagggagtac
tacaacgcatatttgaccaccgcgacccaggatgacccgaagatggttcttccggaaggc
aagagaatgcgaatcgctattattcacgtcggtgccccagctggtggtatgaaccaagca
acccgtgccgccgttgcatactgcctaacccgtggccacaccccgctggctattcataac
ggtttccccggattgtgccgtcaccacaacgataagccagtcagctcagtccgcgaggtc
acttggctggaagctgatagctgggtcaacgagggtggttcagacattggaactaaccgt
agcctgccctcagctgatatggcggaaaccgccaaatgctttgagctgtacaagtttgat
gccctgtttgttgttggtggtttcgaggctttcacagccgtcagtgagctgcgccaggct
cgtgcgcagtatgatgcgttcaagattccgctcatcgtgctcccagctactatttccaat
aacgtcccgggcactgaatattccttgggcagtgacacctgcctgaacaccctgatcgac
ttctgtgatgccattcgtcaatctgcctcctcttctcgccgccgagtgttcgtgattgag
acccaaggtggcaaatctggatacatcgcaaccacagctggcctcgccgtgggtgccgtg
gctgtgtacattcctgaagagggtgttgatatcaagatgctctcgcgcgatatcgacttc
ctgcgtgagaacttcatccgcgacaaaggagctaaccgtgcaggcaagatcattctgcgt
aacgaatgtgcgtccggcacatacactacccaggtgatcgccgacatgatcaaggaagag
gcaaagggccgcttcgagtctcgcgccgctgttcccggtcacttccagcaaggtggaaag
ccttcgccaatggatcgtgttcgtgctttgcgtatggccatcaggtgcatgcagcacatc
gaaggatatgccggcaagagtggtgatgaaattgccgcggatcctacctccagtgccgtg
attggcgtcaaaggctcacgtgtgctattctcccccatgggtggtgagtctggtctggaa
gctaccgagactgattgggcgcgccgtcgccccaagtccgagttctggcttgaactgcag
gacgtcgtgaacgtcctgtctggacgcagccacgctaacaactcgagctggtcctatgag
agtacgtaa

DBGET integrated database retrieval system