KEGG   Penicillium chrysogenum: Pc12g13500Help
Entry
Pc12g13500        CDS       T01091                                 

Definition
Pc12g13500
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pcs  Penicillium chrysogenum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:pcs01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pcs01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pcs00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pcs00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pcs00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pcs00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:pcs00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 782 aa AA seqDB search
MEPTKIAAQPAKRRRIGVLTSGGDAPGMNGAVRAVVRMAIHCDCEAYAIFEGYEGLVNGG
NMIRQLHWEDVRGWLSRGGTLIGSARSLAFRERVGRMKAAKNMVLRGIDALVVCGGDGSL
TGADVFRAEWPGLLADLIASGELSPEQVEPYKVLNIVGLVGSIDNDMSGTDATIGCYSSL
TRICDAVDDVFDTAFSHQRGFVIEVMGRHCGWLALMSAISTGADWMFLPEMPPRDGWEDD
MCSVITKNRTERGKRRTIVIVAEGAQDRQLNKVSSSKIKDILTDRLGLDTRVTILGHTQR
GGAACAYDRWLSTLQGVEAVRAVLEMSPESPSPVITIRENKIMRTPLMEAVQATKDVTAK
IDKKEFDEAMTLRDPEFREYYNAYLTTATQDDPKMVLPEGKRMRIAIIHVGAPAGGMNQA
TRAAVAYCLTRGHTPLAIHNGFPGLCRHHNDKPVSSVREVTWLEADSWVNEGGSDIGTNR
SLPSADMAETAKCFELYKFDALFVVGGFEAFTAVSELRQARAQYDAFKIPLIVLPATISN
NVPGTEYSLGSDTCLNTLIDFCDAIRQSASSSRRRVFVIETQGGKSGYIATTAGLAVGAV
AVYIPEEGVDIKMLSRDIDFLRENFIRDKGANRAGKIILRNECASGTYTTQVIADMIKEE
AKGRFESRAAVPGHFQQGGKPSPMDRVRALRMAIRCMQHIEGYAGKSGDEIAADPTSSAV
IGVKGSRVLFSPMGGESGLEATETDWARRRPKSEFWLELQDVVNVLSGRSHANNSSWSYE
ST
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggagcccacaaaaatcgccgctcagccggctaagagacgccgcattggtgtcctcacc
tctggtggagatgctcccggtatgaacggtgccgtgcgggctgttgtccgtatggcaatt
cactgcgactgcgaagcctacgccattttcgaaggatacgaagggctggtcaatggcggc
aacatgatccgccagctgcactgggaggatgtacgcggctggttgtcccgcggtggcacc
ctgatcggttctgcccgcagcttggcattccgtgagcgtgttggccgtatgaaggcagcg
aagaacatggtccttagaggtatcgatgctctagtcgtctgtggtggtgacggcagtttg
actggtgccgatgtcttccgtgccgagtggcccggcctgttggcagacctcattgcctcg
ggggagttgtcccctgagcaggtggaaccctacaaggtgttgaacattgtaggccttgtt
gggtcgattgacaacgatatgtctgggacagatgccactatcggttgttactcgtccttg
acccgtatctgtgatgccgtcgacgatgtctttgatactgctttctcccatcagcgtggt
ttcgtcattgaggtcatgggccggcactgtggatggcttgccttaatgtccgccatcagt
actggtgcggactggatgttccttcctgaaatgccccctagggacggttgggaggatgat
atgtgctccgtaatcaccaagaaccgaaccgaacgcggaaagcgccgtacgatcgttatt
gtcgccgagggagcccaggatcgccaattgaacaaggtctcgagctcgaaaatcaaggat
attctcacagatcgtctgggattggacacccgagtcacgattctaggccacacccaacga
ggtggcgcggcatgcgcttatgaccgctggctgtcgactctccagggtgtggaggccgtt
cgtgctgtgctagaaatgtcacctgagtctccttcaccagttatcaccatccgcgagaac
aagatcatgcgcacccctctgatggaagcagttcaagcaacaaaagatgtgacggcgaag
atcgacaaaaaggaattcgacgaggccatgacgctccgggatcctgaattcagggagtac
tacaacgcatatttgaccaccgcgacccaggatgacccgaagatggttcttccggaaggc
aagagaatgcgaatcgctattattcacgtcggtgccccagctggtggtatgaaccaagca
acccgtgccgccgttgcatactgcctaacccgtggccacaccccgctggctattcataac
ggtttccccggattgtgccgtcaccacaacgataagccagtcagctcagtccgcgaggtc
acttggctggaagctgatagctgggtcaacgagggtggttcagacattggaactaaccgt
agcctgccctcagctgatatggcggaaaccgccaaatgctttgagctgtacaagtttgat
gccctgtttgttgttggtggtttcgaggctttcacagccgtcagtgagctgcgccaggct
cgtgcgcagtatgatgcgttcaagattccgctcatcgtgctcccagctactatttccaat
aacgtcccgggcactgaatattccttgggcagtgacacctgcctgaacaccctgatcgac
ttctgtgatgccattcgtcaatctgcctcctcttctcgccgccgagtgttcgtgattgag
acccaaggtggcaaatctggatacatcgcaaccacagctggcctcgccgtgggtgccgtg
gctgtgtacattcctgaagagggtgttgatatcaagatgctctcgcgcgatatcgacttc
ctgcgtgagaacttcatccgcgacaaaggagctaaccgtgcaggcaagatcattctgcgt
aacgaatgtgcgtccggcacatacactacccaggtgatcgccgacatgatcaaggaagag
gcaaagggccgcttcgagtctcgcgccgctgttcccggtcacttccagcaaggtggaaag
ccttcgccaatggatcgtgttcgtgctttgcgtatggccatcaggtgcatgcagcacatc
gaaggatatgccggcaagagtggtgatgaaattgccgcggatcctacctccagtgccgtg
attggcgtcaaaggctcacgtgtgctattctcccccatgggtggtgagtctggtctggaa
gctaccgagactgattgggcgcgccgtcgccccaagtccgagttctggcttgaactgcag
gacgtcgtgaacgtcctgtctggacgcagccacgctaacaactcgagctggtcctatgag
agtacgtaa

DBGET integrated database retrieval system