KEGG   Penicillium chrysogenum: Pc12g13930Help
Entry
Pc12g13930        CDS       T01091                                 

Definition
Pc12g13930
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
pcs  Penicillium chrysogenum
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Pc12g13930
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Pc12g13930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1414 aa AA seqDB search
MAGWIGWVFTLIFHTLPSVLYSIITFATLTLPTWLFTLFSMSLTFTMNFTTIMLIFLALV
STVSWFIRYRYLNMYSRLPPEPQRKEAQVDLFPDIQEGDSKPGLANYLDEFLSAIKVFGY
LERPVFHELTRTMQTRKLIAGETLMLEEEKGFCMVVDGLVQIFVKSARERKSGSQENLHM
DDASSDEEGRNIHNRQGYQLLTEVKNGASMSSLFSILQLFTEDIELRNSGSHGSSISSPS
LGQTHVPDTFALSPGKQNARRKRRKSVHPDIVARATVDTTIAIIPASAFRRLTRVYPRAT
SHIVQVILTRLQRVTFATAHSYLGLTSEVLDIERQMSKFTSWDLPNNLRGSALDRLKDKF
TRERDRLGPEEVGKGIALHNPSASRRGRSSSTLRKEAFLQAKAASERPLKPLTPQRSSPA
FIDRESAGVSPGDLLSTIQLSRFGPRHDHLAPRLQSPLTEREQPQFVSTAARNALPSTFQ
RSESVDEDSIFRESILDCIMKGIGLTEGTRNTLRKRSHSGEASPRLLSYDNRRQKAVFSN
AFGFIDPYEGSGDAESESMMSSMSVTSAGGTSPIINLREDLLHDMEVVYFPQGSVLVEQG
ERHPGLYYVIDGFLDAGIPANERDDALIGASHGSASQAQEDLFPKLRRTTTASSRSPGAA
GGNDPRRKTQSRKSLYLIKPGGIQGYVGALASYRSYTDVVAKTDVYVGFLPRASLERIAD
RHPTALLTLAKRLTRLLPRLLLHIDFALEWVQVSAGQVIYHQGDESDAIYLVLNGRLRSV
LEGPNAKITVVGEHGQGESVGELEVMTESTRPSTLHAIRETELAKFPRSLFNSLAQEHPG
ITIQVSKLIAQRIRDLVEHPLSEKGIEQGHAGGVQTATSTVNLRTVAILPVMAGVPVVEF
GNRLLQALHQIGVTRGVTSLNQATILNHLGRHAFSKMGKLKLSQYLADLEEKFGMVLYIA
DTNVNAPWTQTCIAQADSILLVGLAESSPRIGEYERFLLGMKTTARKELVLLHAERYCSP
GLTREWLKNRVWINGGHHHIQMAFRSTTEPSHPPSKKFGTVLKQRVQILQAEIQRYTSRR
AQQTPLYSPQTPFKGDFHRLARRLCGKSVGLVLGGGGARGISQVGVIKALEEAGIPIDII
GGTSIGSFIGALYARDADVVPMYGRAKKFSGRMGSMWRFALDLTYPTVSYTTGHEFNRGI
FKTFGDSQIEDFWLEFYCNTTNISRSRIEYHSSGYVWRYVRASMTLAGLMPPICDEGSML
LDGGYIDNLTVAHMKSLGANVIFAIDVGSIDDNTPQGFGDSLSGFWSVFNRWNPFSSLPN
PPTLSEIQARLAYVSSFDNLERAKSTAGCLYMRPPIDPYGTLEFGKFDEIYQVGYAYGKE
FLDRLKSEGSLPIPEETEEKRKLQRTMAPRRASI
NT seq 4245 nt NT seq  +upstreamnt  +downstreamnt
atggcggggtggatcggatgggtttttaccctcatatttcataccctcccaagcgttctc
tactcgataatcacattcgcgacgcttacactgcccacatggctcttcacgctcttctct
atgagcttgactttcaccatgaatttcaccaccataatgttaatattccttgccctggta
tcgaccgtcagctggttcatccgttaccggtacctgaacatgtacagtcgcctgccccca
gaacctcaacgcaaagaagcccaggtcgatttgttccctgatatccaggaaggggattca
aagccagggcttgccaattatctcgatgaattcctcagcgctatcaaagtctttggctac
cttgaacggcccgtctttcacgaattgacccggacgatgcagacgaggaagctgattgcg
ggggagacactgatgctggaggaggagaagggcttctgcatggttgtggatgggctggtc
cagatcttcgtgaagtctgcacgcgaacggaagtcaggctcgcaagagaatctccacatg
gatgatgcctcctcagacgaggagggccggaacattcacaaccgacagggctatcagctc
cttactgaggtcaagaacggcgcttcgatgtcatctttgttctctattcttcagctgttt
actgaagacatcgagctccgcaactcgggaagccacggctccagtatatcgagtcctagc
ctgggccagactcatgtgcctgataccttcgccctcagtcccggtaagcaaaatgcccgg
agaaaacgtcgcaagtctgtacacccagatattgtggcacgggctacagtggacacaacg
attgctatcatcccagcgagcgcattccgccgactgaccagagtctacccacgggcaacg
tcgcacattgttcaggttatcctgacacgtctccagcgggtcacattcgctacagcgcat
tcttatctggggttgaccagcgaagtcttggacatagaacggcaaatgtctaaattcacc
tcctgggaccttccgaacaatcttcgagggagtgccttggatcgcctaaaggacaaattc
acgcgagagcgagatcgattgggaccggaggaagttggaaaaggcattgctcttcacaat
ccttctgccagccgtagaggacgctcgagcagtactctcagaaaagaagcctttttacaa
gcaaaggcggccagtgagcgtcctctcaaacccttaaccccacaaaggtcatcaccagcg
ttcattgacagggagtcggcaggtgtcagccccggtgacctgctatcaacaatacaattg
tctcggtttggaccgcgacatgatcatttggcacctcgcctccagtctcctcttactgag
cgggagcaacctcagtttgtatccactgctgcaaggaatgccctgccctcgactttccag
cgaagtgagtcagttgacgaggactctatcttccgcgagtcgatcttggactgtatcatg
aaggggattgggctcactgaaggcacacgcaatactctgcgcaagaggagccactctggc
gaggcgtcgccaagacttctctcctacgataaccgccgccagaaggccgtcttctccaat
gcctttggtttcatcgatccctacgaaggctctggtgacgctgaatccgaatccatgatg
tcctcgatgtcagtgacgagtgcaggtggaacctctcctatcatcaacctacgggaagac
ctcctccatgacatggaggtagtctactttccacaaggctcggttctggtggaacagggt
gagcgccatccaggcctctactacgtcattgatggattcttggacgcgggtattccggcg
aatgagcgcgatgatgccctaattggggcctctcatgggtctgcctcgcaagcacaagag
gacctattcccgaagctgagacgaacaacgacagcatcgtcgcgcagccctggtgcagcg
ggcggcaacgaccctcgacggaagacccagtcccgcaaatcgctatacctgatcaaacct
ggtggcattcaagggtatgtaggtgctcttgcatcgtaccgctcgtacaccgatgttgtg
gccaagacggatgtttacgtcggattccttccccgtgcttccctcgagagaatcgcagat
agacatccaactgctctgttaacgctggcgaagcggttgacaagactgctgccccgttta
ctgctccacattgattttgcgctagagtgggtgcaggtcagcgcaggacaggtgatttat
caccaaggggatgaaagtgatgctatttatcttgttctgaacggtcgtctgaggtctgtc
cttgagggaccaaatgccaagatcactgtcgttggcgaacacggccagggtgagagcgtt
ggcgaactcgaggtcatgactgaatctacaagaccatctactttgcatgctattcgcgaa
accgagctagccaagttcccccggtctcttttcaacagcctcgcccaggaacatcctgga
attaccatccaggtctctaaacttattgctcagcgaattcgtgacttagtcgagcatccg
ctgtctgaaaaaggtattgaacaaggacatgctggcggtgttcagactgcaacctcaaca
gtgaatcttcgcaccgtggcaatccttccggtcatggctggcgtcccggtcgtggaattt
gggaataggctcttgcaggcgttgcaccaaattggtgtgaccagaggtgtcacatcactc
aaccaagcgaccatcttgaaccacttgggtcgccatgccttcagtaagatgggaaagctt
aagctttcccaatacctggctgaccttgaagagaaattcggaatggtcttgtacatcgct
gacaccaacgtgaatgcaccgtggactcaaacttgcatcgcgcaagctgattctatattg
ttggtgggtctcgcagagtcttcgcccagaattggtgaatatgagcggttcctgctgggt
atgaagaccactgctcgtaaagaactcgttcttttacacgcggaacgatactgttcacct
ggactcactcgagaatggctgaaaaaccgggtgtggatcaacggtggccatcaccacatt
caaatggcattccgctcgaccactgagccttcgcacccgccgagtaagaagttcggcacc
gtgctgaagcagcgcgtgcaaattctgcaagctgaaatccaaaggtacacgtcccggcgt
gcacaacaaactccactctattccccgcaaacccctttcaagggtgatttccatcggctg
gctcggcgtttatgcggcaagtctgtcggacttgtactgggcggaggtggagcgcgtggt
atttcgcaagttggcgtcattaaagcgctggaggaggccggcatcccaattgatatcatt
ggtggcacatcgatcggttctttcattggagctctgtacgcgcgtgacgctgacgttgtt
cccatgtacgggcgagccaagaagttctctgggcgcatggggagtatgtggcgatttgca
ttggacctgacctatcccactgtttcctacaccacgggccatgagttcaaccggggaatc
ttcaagacctttggagacagtcaaattgaagatttctggttggagttctactgcaacaca
actaacataagtcgatcccgaattgagtatcactcgtctggttacgtctggcggtatgtc
cgggcctcgatgactctggccggcctgatgcctcctatctgtgatgaaggcagtatgctc
ctggacggtggctacatcgacaatctcaccgtggcacatatgaagagtcttggagcgaat
gtcatattcgcaattgacgttgggtctatcgacgacaacaccccccagggattcggagac
tcgctgtcaggattctggtcagtgtttaaccgttggaaccccttctcctcactcccgaac
ccacctacactttccgaaatacaagcacgactggcctatgtctcatcgttcgacaatctc
gagcgagcaaagagtacggctggctgtctatacatgcgtcctcctatcgacccatacggc
accctagaattcggcaaattcgacgagatataccaagtcggctacgcatatggaaaggag
ttcctcgaccgcttgaagagcgaaggctcactgcctattccggaggaaaccgaggaaaag
cgcaagctgcagcggacgatggctcctcggcgagctagtatctaa

DBGET integrated database retrieval system