KEGG   Penicillium chrysogenum: Pc12g15470Help
Entry
Pc12g15470        CDS       T01091                                 

Definition
Pc12g15470
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pcs  Penicillium chrysogenum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pcs00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 631 aa AA seqDB search
MKLSWSLVLSSAAAATASYSGNLNYRSPSEHHPGLGVSIHRVAKRGVPGSSFDPSKLHFT
HGVASGDPYADSVILWTRCSPTFDDVHSNTSTHGLVPLYNPVPIYSGNEDAEEQVAVSNA
PICLDYKVSDDESFKQIAAEGTVYTSSDIDYTVKVEASKLKPFTTYFYQFQVCNSDNKSP
VGRTKTAPDSEKEVDQVNLAVYSCANFPFGFFNAYGHSVRKDSVDYVVHLGDYLYEYKNG
EYGWGNSMGRIPLPDRTIVTLYDYRKRLATYRTDLDLLASHQNFAWIPVWDDHEVADNTY
RDGSSELRNDEKSFIQDGGVSVDQRKMNAVRAYFEWMPIRQVEMDDNLRIWRNFKLGKLV
DLIMLDTRQYDRSITDTYDNTNYIDEIKDDAGRSLMGSRQENWLQRNLIESANRGAHWRI
LGSQIIFSQLNMSATMGPEQPLNLDAWDGYMASKNRTLQTLYDNKIGNNIVIAGDTHVNW
VSDLAWLDHTPYDSSTGSGSIGVEFGGAAVSSPSSFGQNTTIPAANNISQIVATDSESLQ
WSEGYYRGYFELHITPEQVGAHFFGLPTTKERNFGEISLANFTVKSGENHLQRNSDNAAA
GGIVENGFLKNGKVVQSGMVYDTETGRYYSN
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctcctggtctctcgtgctgtcatctgcagccgcagccactgcgagctattca
ggcaatctgaactaccgcagtccgtccgagcaccatccaggactcggtgtctccattcac
cgtgttgcgaagcgcggggtccccggatcgtcctttgacccatccaagttgcacttcacc
catggagttgcttctggagatccctatgcagactcggtgattctctggactcgctgctcg
ccgactttcgatgatgttcactcgaatacctctacacatggtcttgttccattgtacaac
ccagtcccgatctactcagggaatgaagatgcagaggagcaggtggccgtgtcgaatgct
cctatttgcttggattacaaagtctctgacgatgagagcttcaagcaaattgcagcggaa
ggcactgtgtataccagttccgacattgactatactgttaaggtcgaagcatccaagttg
aagccattcaccacctatttctatcagttccaagtttgtaattcggacaacaagagcccg
gttggaagaaccaagactgctcctgattcggagaaagaggtcgaccaggtcaacctggcc
gtttactcttgcgccaacttcccattcggtttcttcaatgcctacggacactctgtgcgc
aaggattccgtggactacgtcgtccatctcggtgattacctctacgaatacaagaatggt
gaatatggctggggtaacagcatgggacgcatccctctgccggaccgaaccatcgtcacc
ctttatgactaccgcaagcgccttgccacctacagaaccgacttggatctgcttgccagt
catcagaactttgcttggatccctgtctgggatgaccacgaggtcgccgataacacctac
cgggatggctcttcggagctcaggaacgacgaaaagtcttttattcaggacggaggtgtc
tccgttgaccagcgtaagatgaacgccgtccgtgcttacttcgaatggatgcccatcaga
caagtcgagatggacgataaccttcgcatctggagaaacttcaagctcggaaaattggtg
gacctgatcatgctggacaccagacaatacgaccgctccatcaccgatacctacgataac
actaactacatcgacgagatcaaagatgacgccggtcgcagtctgatgggaagccgtcag
gagaactggctgcagcgaaacctgattgagtcagccaaccgtggtgctcactggcgcatc
ctcggcagccaaatcattttctctcagttgaacatgtcagctactatgggccccgagcaa
ccactgaacctggatgcttgggatggttatatggcgagcaagaacagaaccttgcagact
ctctacgacaacaagattggaaacaacatcgtcatcgcgggagatacccacgtcaactgg
gtcagcgatctagcctggctcgaccacaccccttacgactccagcactgggtccggctcc
atcggtgtggagttcggtggagcggccgtcagctctccctcctcattcggacagaatacc
actattcctgcggcaaacaatatctcccagatcgttgctactgatagtgagtcactgcag
tggtctgagggatactaccgtggatactttgagctccacatcaccccagagcaagtcgga
gctcatttcttcggcttgcctaccaccaaggagcgcaatttcggggagatctccctggcc
aacttcactgttaagagcggtgagaaccatttgcaacggaactcggacaatgcggccgct
ggcggaatcgtggagaatgggttcctcaagaatggaaaggtcgtgcagagtggcatggtc
tacgatactgagaccggtcgttactattcgaactag

DBGET integrated database retrieval system