KEGG   Penicillium chrysogenum: Pc12g16470Help
Entry
Pc12g16470        CDS       T01091                                 

Definition
Pc12g16470
Orthology
K07204  
regulatory associated protein of mTOR
Organism
pcs  Penicillium chrysogenum
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1449 aa AA seqDB search
MRDPTTDMEHNSQQTTNGSTASRRNPNKSVRVAFGPELETTIPTRERSPAPLSGHHRSLT
EVEHKQPTLTPHGRPTSSSGDNTANGEIPPRRPSPRRSESSRPAMLKRARSDYGPSRITF
DKVAGDDDEDFAMRHGWQEEYTSSEYLKILHSNFYMYFTEKRHETNGIPRDPVGSWPSQD
WRMKDRLKTVSAALAICLNIGVDPPDVVKTNPTSKLECWVDPTSTTGGGQNKIMEQIGKK
LQEQYETLSLRTRYKQYLDPSVDETKKFCISLRRNAKDERVLLHYNGHGVPLPTQSGEIW
VFNKNYTQYIPVPLYDLQSWLAGPSLFVFDVSHAGNIVQNFHTFVEKHEKENIETRKRDP
NAVIQNYGDCILLAACQKTESLPTNPDLPADLFTCCLTTPIEIALRFFILQNPLRTNISI
DDFRVPGRLQDRRSPLGELNWIFTAITDTIAWNTLPRALFKKLFRQDLMVAALFRNFLLS
ERIMRTYKCHPISSPELPDTHHHPLWKSWDLAVEMVLSQLPALIDQEEGRRQYEYQHSTF
FAEQLTAFEVYLSSGPMEKNPPDQLPIVLQVLLSQAHRLRALILLSKFLDLGPWAVHLAL
SIGIFPYVVKLLQSAAQELKPVMVFIWARIMAVDHTVQNDLLKDNGIHYFISILNPSSPI
PVGNASEHRAMCAFIVSIFCKNYPQGQNVCLSGELFDSCLRHLGDVENPLLRQWSCLSLS
MLWCDFPEAKWMGIRCAAPARLCELNFDPVPEVRAAMLHAVTTFLGIPDLTDQVAQIEET
LALAVLPMSADGSVVVRKELLVFFSTFVRRHQNKFLVAAFEELEEEKRSLSHRWESENSR
TSRSEGQTGALVSHAKHTQLSRNTTFGTIWKQLLALSVDPHPDIAQDAAVIVDYIHLTLL
ESPMAPLANKLQNEVLEITGLTKFQPRERTEAKKTAPPPTPPLSGTAPSKQEGYLSLSFR
RTASVAASLKNLAFGNSATGDPSSDNSNPPSPSTSRMTITPRGRAPPEWTRPPEGNDHVA
PATAYHQAPIPTSRGFQPKGFGVVPVIPLKSRFLDWSTEYFREPQMKPNEPDEPGSSDYN
QRLWRRGRNEKIIAETQPLKGKAGASRWDNSVALLSNGSQPHKMCFHQFEDHIAVADDRD
TIAIWDWQNHKRLNQFSNGNPVGSKINEVRYINEDDQALLMTGSSDGVIKLFRHYETNKD
IEVVTAFRALPELIPSNRNAGLVLDWQQGQGKALVAGDVKVIRVWNAATEVCTNDIPARS
GSCITSLTSDQVAGNIFVAGFGDGAVRVFDQRLKPTTSMVKVWREHKQWITNVHMQRGGL
RELISGGRNGEVRLWDLRMDNPISTIYATKDTLRTLSVHEHAPVFSMYVSSAAISCHFVC
SKLTCRRGTNRHEVKTFNVDGTYLSTFEPYSSFLHHNRSSPIASTAFHPHRTVLACAALN
DHHVNLVSC
NT seq 4350 nt NT seq  +upstreamnt  +downstreamnt
atgagggatcccactaccgatatggaacataactcacaacaaacgaccaacgggtcgaca
gcttcacgtcgcaatccgaataaatcggtccgcgtcgcgtttggtcccgagttagagact
acaattcccacccgcgaaagatctccagctccgttgagtggccatcatcgctcgctcact
gaagttgaacacaagcagcccacattaaccccacacgggcgcccaaccagctcatcggga
gacaacactgccaacggggagatcccaccccgccgcccatcgcctcggagatcggagagt
agccgaccggctatgctgaagagagccagaagtgactatggaccaagtcggataaccttc
gataaagtggcaggtgatgacgatgaagatttcgctatgcgacatgggtggcaggaagaa
tacacttctagtgaatatctcaagatcttgcattcgaacttctacatgtatttcaccgag
aaacgccacgagaccaacggtattcccagggacccagtcgggagttggccaagtcaggac
tggcgcatgaaggatcgcctgaaaactgtgtctgcggccttggccatctgtctgaacatt
ggagtcgaccctcccgatgtggtcaagaccaacccaacatcgaagcttgaatgctgggta
gatccgacttctaccacaggcggtggtcaaaacaagatcatggagcagatcggcaagaaa
ctacaggagcaatacgaaactttgagtcttcggacaaggtacaaacagtacctagatcca
tcagttgatgagaccaagaaattctgcatctcacttcgccgaaatgccaaggatgagcgg
gtgcttctacattacaatggacatggagtgccgctgccaactcagtcgggtgaaatatgg
gtcttcaacaagaactatacccagtatatacctgtcccactgtatgatctgcagtcttgg
ctagctgggcctagtctttttgtcttcgatgtttcacatgcgggcaacattgtccaaaat
ttccatactttcgtggagaagcatgagaaagagaatattgaaactaggaaacgagaccca
aatgccgtcattcagaattatggtgactgtatccttctagctgcgtgccagaagacagag
tcccttccgaccaatcccgacctacctgcagacctattcacctgttgcttgacaacaccg
attgaaattgcattgcgctttttcatcttacaaaaccctttgcgcacgaacatttctatt
gacgacttcagagttccaggtcgactccaagatcgtcgaagccctcttggggaactgaat
tggatcttcactgccattaccgatacgattgcgtggaacaccttacctcgggctttgttc
aaaaagctcttccgacaggatctaatggtcgccgctcttttccgcaactttttgctcagc
gaacgcatcatgcgcacttacaaatgccatcccatttcttcgcccgaattgccggacaca
catcatcacccgctatggaaaagctgggaccttgcagtcgaaatggtgttatctcaacta
cctgctctcattgatcaagaagaaggacgtcggcagtatgagtaccagcactcaacgttc
ttcgctgagcaactcactgcttttgaggtatacctctcgtccggtcccatggagaagaat
ccaccggatcagcttcctattgtcctccaagtcctcctgagtcaggcacaccgtttgcgg
gccttgattcttttgagcaaattcctggacctcggaccgtgggctgtgcaccttgcactc
agcattggcatattcccgtatgttgtcaagttgctgcaatcagcagctcaggaattgaaa
ccagttatggttttcatttgggcgagaatcatggcagtcgaccacactgtacaaaacgat
ctactcaaagacaacggcatccactactttatctcgattctaaatccttcttcgcccatt
cctgtgggaaacgccagtgaacatcgggccatgtgtgctttcatagtctcaatcttctgc
aaaaactatccccagggacagaacgtctgcctttctggcgagttgttcgattcatgcctc
agacatctgggcgatgtggaaaatcccttgctacggcagtggtcttgtctgtctctcagt
atgctctggtgcgattttcccgaagcgaagtggatgggcattcggtgtgcagcccccgct
aggctctgcgaattgaatttcgatccagtgcccgaagttcgtgctgccatgcttcacgct
gtgactacattcttggggattccagatctgacagaccaagttgcacaaatcgaggagact
ttggcactggcggtcttgcccatgtctgctgatggtagtgtggttgttaggaaagagctt
ttagtattcttctcgacattcgtcagacgccaccaaaacaaatttttggtcgcagcattt
gaggagcttgaggaagaaaagcggtcgctgtctcatcgctgggagagcgaaaactctcgg
actagccgctccgaagggcagaccggagcactagtttctcatgcgaaacacacccagctg
tctcgcaacacgactttcggaactatctggaagcagttgctagctctctcagttgatcct
catcctgacatcgcccaggatgccgccgttatcgttgattatatccacttgaccttgttg
gaatctccaatggcgccactcgctaacaagcttcagaatgaggttctggagatcacaggc
ttgacgaaattccaacctcgcgagcgaactgaagcaaagaagactgcgccacctccaacg
ccacctttatctggaacagcaccctcgaaacaagaaggctatctttctttaagttttagg
cgaactgccagcgtcgctgcttccctcaagaaccttgcttttggcaattcagcaacagga
gacccatcctcagataattcgaaccccccttcaccttcaaccagccgtatgacaattacc
ccacgcggccgggcccctcctgagtggacccggcccccggaaggaaatgatcatgttgct
cccgcgacagcataccaccaggctccgattcccacctcccgagggttccaacccaaaggc
tttggcgtcgtgcctgtcattcccctaaagagtagattcctggattggtccactgagtat
ttccgggagccccagatgaaacccaacgagccggatgagcccggtagctccgactacaac
cagcgcctctggagacgcggccgcaacgaaaagatcatcgccgagacccaacccctcaaa
gggaaagctggagcaagccggtgggataactcggttgctttgctatcgaatggtagccag
ccccacaagatgtgcttccatcaattcgaggatcacattgctgtcgcggatgaccgggat
acaattgcaatttgggactggcagaaccacaaacgcctcaatcaattctcaaatggcaac
ccggtcggatcaaagatcaacgaagttcgatacatcaatgaggacgaccaggcactgctt
atgactggatcgtccgatggtgtgatcaagcttttccgccattacgagactaataaggat
attgaagtggttacagccttcagagccctccctgagctgattccaagcaatcgcaacgca
ggtcttgtgctcgattggcagcaaggtcaaggcaaagctctggttgcaggtgatgtgaag
gttatccgtgtctggaatgctgctactgaggtgtgcacaaacgacattcccgcacgatcg
ggttcttgcatcacatccttgacgtctgaccaggttgcgggcaacatattcgttgccggt
ttcggtgacggtgctgtccgagtctttgatcaacggttgaagccaaccacatccatggtc
aaagtttggcgtgagcacaagcagtggattacaaatgtccatatgcagcgtggtggtcta
cgagaattgatatcaggtgggcgtaacggtgaggtccgactttgggatcttcgcatggat
aacccgatctccaccatctatgccaccaaagataccctgcggaccttgagtgttcacgag
cacgctcctgtcttcagcatgtacgtttcctccgccgcaatttcttgtcatttcgtttgt
tccaagctaacatgccgcaggggtacaaatcgtcacgaagttaagactttcaacgtggat
ggtacctatctttctacgttcgagccatactcgagcttccttcatcacaaccgatcctcg
cccattgccagcactgctttccatccccaccggactgtgcttgcctgcgccgcattgaat
gaccatcatgtaaatcttgtgtcctgctaa

DBGET integrated database retrieval system