KEGG   Penicillium chrysogenum: Pc13g03420Help
Entry
Pc13g03420        CDS       T01091                                 

Definition
Pc13g03420
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pcs  Penicillium chrysogenum
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:pcs04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 505 aa AA seqDB search
MLHSASLLLVSLLAALPVNADGLYTKNSPVIQLNPKTYNSLIANSNYTSIVDSLPPQPSL
THPLRFYAPWCGHCKNLKPAYEKAAKNLDGLAKVAAINCDDDENKPFCGQMGVQGFPTLK
IVTPSKKPGKPRVEDYQGARSAKGIVDAVVDRIPNHVKRATDKDLDKWLGQNEDRPKAIL
FTEKGTTGALIRALAVDFLGAIDIAQVRNKESASVKKFDVTEFPTLVLIPSADAEPKIYA
GDLKKKPITEFLSQAAAPNPDASPRSASNSKPKQKSKPASKPTSVVDDAEDLKPTASQDQ
DETDPSEKPVQVPIPAPPIPTLATPESVESACLTPKSGTCVLVILPETSEPDAALPAHAT
EALASVAEIGHKHALRGTHLFPLYAVPAINTASKTLREALELADGQTVEIIALNARRGWW
RRFSGADADFGAVAVESWVDAIRLGDGTKEKLPEGIVVSVEAETESEAEVKPEAEAEVEP
EAETVEAEAETKAETEEQAAEHDEL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgctgcacagcgccagcctcttgcttgtgtcgctccttgcggcactgcctgttaacgcc
gatggactatacaccaagaattcgccggtgatccagttaaatcccaaaacttacaactcg
ctcattgcaaactcgaactatacctcgatcgtcgactctctgcctccccaaccttcactc
acacacccacttagattctacgcgccctggtgcggccattgcaagaacctcaaacctgcc
tacgaaaaagccgcgaaaaacctcgacggactcgcgaaagtcgccgcgatcaactgcgac
gatgacgaaaataaacccttctgcgggcagatgggtgtccagggcttccccacactgaaa
atcgtgacaccctcgaaaaagcccggaaagcctcgcgtcgaggactaccaaggcgcgcgc
agcgccaaaggtatcgtcgacgccgtcgtcgaccgcatccccaaccacgtgaagcgcgca
acagacaaggacctggacaaatggcttggacaaaacgaagaccgacccaaggccatcttg
ttcaccgagaagggcacaacaggcgcgctgatccgcgccctggcagtcgacttcctcggc
gcgattgacatcgcccaagtccggaacaaggaatccgcctctgtgaagaagttcgacgta
accgagttcccgacactcgtcctcatccccagcgccgacgccgagcccaagatctacgcc
ggcgacctgaagaagaaacccatcaccgagttcctcagccaagcggcagcaccaaaccca
gacgcctcaccccgctccgcctccaactccaagccgaaacaaaagtccaagcctgcttcc
aagcctacctccgtcgtcgacgacgccgaagacctcaagcccaccgcctcccaggaccag
gacgaaacagatccgtcggagaagcccgttcaggttcccatccccgcacccccaatccca
accctcgccacccccgaatccgtcgagtcagcctgcctaacaccaaagtccggcacctgt
gtgctagtcatcctccccgagacgagcgagccggatgctgcgcttccagcgcatgccacc
gaggcactcgcgagcgtcgctgagatcggacacaagcacgctctgcgcggaacgcatctc
ttcccgctgtacgctgttcctgccatcaacactgcgtctaagactctgcgtgaggcattg
gaattggctgatggccagacggttgagattatcgctttgaatgcgcgtcgtggatggtgg
cgtcggttcagcggtgccgatgcggacttcggggctgttgctgttgagtcttgggttgat
gcgattcgcttgggtgacgggactaaggagaagttgcctgagggcattgttgtcagtgtt
gaggctgagactgaatccgaggctgaggttaagcctgaggcggaagctgaggttgagcct
gaagctgagacggtcgaggctgaggctgaaaccaaggctgagactgaagaacaggccgcg
gagcatgatgagctgtga

DBGET integrated database retrieval system