KEGG   Penicillium chrysogenum: Pc13g03920Help
Entry
Pc13g03920        CDS       T01091                                 

Definition
Pc13g03920
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
pcs  Penicillium chrysogenum
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Pc13g03920
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pc13g03920
   00640 Propanoate metabolism
    Pc13g03920
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Pc13g03920
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    Pc13g03920
Enzymes [BR:pcs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Pc13g03920
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Pc13g03920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2273 aa AA seqDB search
MGSTMGNSSAVTKHDIPSHFIGGNALESAPPSAVKDFVAAHDGHSVITSVLIANNGIAAV
KEIRSVRKWAYETFGNERAIQFTVMATPEDLTANADYIRMADQYVEVPGGTNNNNYANVE
LIVDVAERMDVHAVWAGWGHASENPRLPESLAASPKKIIFIGPPASAMRSLGDKISSTIV
AQHAGVPCIPWSGTGVDAVKLDENGIVTVEDEVYNQGCTFSPEEGLAKAKEIGFPVMVKA
SEGGGGKGIRKVENEEDFPALYNAAANEIPGSPIFIMKLAGNARHLEVQLLADQYGNNIS
LFGRDCSVQRRHQKIIEEAPVTIAKQPTFQAMERAAVSLGKLVGYVSAGTVEYLYSHSDD
KFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPLHRIRDIRLLYGVDPNTSADID
FDFSKEESFQTQRRPQPKGHTTACRITSEDPGEGFKPSSGTMHELNFRSSSNVWGYFSVG
TAGGIHSFSDSQFGHIFAYGENRSASRKHMVVALKELSIRGDFRTTVEYLIKLLETPAFE
DNTITTGWLDQLISNKLTAERPDQIVAIICGAVTKAHLASEAGIEEYRNGLGKGQVPSKE
ILKTVFPVDFIYEGERYKFTATRASLDSYHLFINGSKCSVGVRALADGGLLVLLSGRSHN
VYWKEEAAATRLSVDGKTCLLEQENDPTQLRSPSPGKLVKFTVENGEHIRSGQSYAEVEV
MKMYMPLIAKEDGIVQLIKQPGATLEAGDILGILALDDPSRVKHAQPFTGQLPELGSPTV
LGNKPSQRFFLLHSILENILRGFDNQVIMGTTLKDLVEVLRNPDLPYGEWNAQSSALHSR
IPQKLDAQLQNVVDRAKARKAEFPAKQLQKAIVRFIEEHIGPADAELLKTTLLPLVQVIN
KYMDGLKSNEYNVFIGLLEQYYDVEKLFSTHNLRDEDVILKLREENKDDITGIVHTVLSH
SRIGSKNNLVLAILDMYRPNQPHLENVGTYFKPILKKLTELESRSSAKVTLKAREVLIQC
AMPSLDERLSQMEHILRSSVVESRYGETGWEHREPSLDVLKEVVDSKYTVFDVLPRFFVH
ADPWVTLASLEVYVRRAYRAYTLKSIDYNASTEQPFLSWDFTLGKLGQREFGVLNSTQPS
APGTPIAEVNPFKRINSIGDMSLFVSDAASDPVRKGVIIPVQYLEDAEEILCKALEVFPV
GGSNAKCPSEQGLIATLEGKRRPAPKPVSDSELTGVCNIAIRDIEDMEDADLVAQMKQLL
ADNKDELLARRIRRVTFICGKQGVYPGYFTFRGPNYEEDLSIRHSEPALAFQLELGRLSK
FNIKPVFTENRNIHVYEAIGKGPENDKAIDKRYFVRAVVRPGRLRDDIPTAEYLISEADR
LMNDILDALEIIGNNNSDLNHIFINFSPVFNLQPVDVEQALAGFLDRFGRRLWRLRVTGA
EIRILCTDPATGMPYPLRVIISNTYGFIINVELYIERKSEKGEWIFQSIGGTAKLGSMHL
RPVSTPYPTKEWLQPKRYKAHLMGTQYVYDFPELFRQAFQNSWTKIAEKIPSLYEKRPPV
GECIDYSELVLDDTDNLVEVSREPGTNTHGMVGWIITARTPEYPRGRRFIIVANDITFQI
GSFGPQEDRFFHKCTELARKLGIPRIYLSANSGARIGVADELIPFFSVAWNNPEKPEAGF
KYLYLTPEVKKRFDASKKKEVITELVNDDGEERHKITTVIGAKDGLGVECLKGSGLIAGA
TSKAYEDIFTITLVTCRSVGIGAYLVRLGQRAIQVEGQPIILTGAPAINKLLGREVYTSN
LQLGGTQIMYKNGVSHMTANDDFAGVEKIVEWMSFVPDKKNAPIPIRPWSDTWDRDVAYF
PPPKQTYDVRWLIGGKEDVDGFLPGLFDKGSFEEALGGWARTVVVGRARLGGIPMGVIAV
ETRSVENVTPADPANPDSMEMIATEAGGVWYPNSAYKTAQALRDFNNGEQLPVMILANWR
GFSGGQRDMYNEVLKYGSYIVDALVKYEQPIFVYIPPHGELRGGSWVVVDPTINPDQMEM
YADEDSRGGVLEPEGMVNIKYRREKQLDTMARLDATYGELRRSLADTSLTNEQLSEVKAK
MAAREEQLLPVYMQIALQFADLHDRAGRMQAKDTIRKPLQWVNSRRFFYWRLRRRLSEET
IVKRMVAASAPAASGVGATGESLRTAHLRTLHAWTGLLDEELEHDDHKVATWYEENKKVV
QSKVESLRTDGVASEVAQLLIGNKEGGLRGVQQVLSMLPVEERENVLKYLGSA
NT seq 6822 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcacaatgggcaacagctcggctgtcaccaaacatgacatcccttcacatttc
atcggtggcaatgccctcgaatcagcacctcctagcgctgtgaaggacttcgtggccgcc
cacgatggtcactccgtcatcacatcggtgcttattgccaacaacggtatcgccgctgtc
aaagagattcgctcggtgcggaaatgggcttacgagaccttcggcaacgagcgggctatc
caattcactgtgatggccacgcccgaagatttgaccgccaacgccgactatattcgcatg
gccgaccaatacgtcgaggttcccggtggaaccaataataataattatgccaacgtcgag
ttgattgtcgatgttgcggagcggatggatgtgcacgccgtgtgggcaggatggggccac
gcctccgaaaaccctcggttacccgaatctcttgctgcgtcgccgaaaaagatcatcttc
attggacctccagcttcggccatgcgctcgcttggtgacaagatttcctctactattgtt
gcacagcacgccggtgtgccttgtattccctggtccggaaccggtgtcgacgccgtgaag
ctcgatgagaacggtatcgtgacagtcgaggacgaggtctataaccagggttgcaccttc
tcgccggaagagggtttggcgaaggctaaggagatcggtttccctgttatggtcaaggcc
tctgaaggtggcggtggtaagggtatccgaaaggtcgagaacgaggaagatttcccggcc
ttgtacaatgccgccgccaacgaaattccgggatcgcctatcttcatcatgaagctggct
ggcaacgctcgccatctcgaggtgcagttgctggctgatcagtacggcaacaacatttcc
cttttcggtcgtgattgttcagttcagcgtcgtcaccagaagattatcgaggaggcccct
gtgaccattgcgaaacagcccaccttccaggcaatggagcgcgctgccgtgagccttgga
aagttggtcggatacgtttcggctggtaccgtcgagtacctctactcgcactccgatgac
aagttctacttcctcgagttgaaccctcgtttgcaggtcgagcatcccaccactgagatg
gtgtcgggagtcaacttgcccgccgcgcagctccagattgctatgggtatccctctgcac
cgcattcgcgacattcgcctcctttacggtgtcgaccccaacacctccgctgacattgac
ttcgacttctccaaggaggagagcttccagacccaacgtcgtcctcagcccaagggtcac
accactgcctgccgtatcacctccgaagatcctggcgagggattcaagccttccagcggt
accatgcacgagctgaacttccgcagttcgtcaaacgtttggggttacttctctgtcggt
actgctggtggtatccacagcttctccgacagtcaattcggtcacatttttgcatacggc
gagaaccgatccgcttcgcgcaagcacatggtcgttgctttgaaggagttgagcattcgt
ggtgatttccgaaccactgtcgaatacctgatcaagctcctcgaaacccccgctttcgag
gacaacaccatcaccactgggtggctcgaccagcttatctctaacaagctgactgctgag
cgccctgatcagatcgtcgctatcatttgtggtgccgtcaccaaggctcacctcgctagc
gaggctggtatcgaggagtaccgcaatggtctaggaaagggtcaggtcccgtccaaggag
atcctgaagactgttttccctgttgacttcatctacgaaggcgagcgttacaagttcacc
gccactcgtgccagcttggacagctaccacctcttcatcaacggctccaagtgctcagtc
ggtgttcgcgccctggctgatggtggcttgctggttctcctcagcggccgcagtcacaac
gtctactggaaggaggaggctgctgccacccgtctcagcgttgacggcaagacctgcctc
ttagagcaggagaacgatcctacgcagctccgttctccttcccccggtaagcttgtcaag
ttcaccgtcgagaatggagagcacatccgatctggacagtcttacgccgaggttgaggtt
atgaagatgtacatgcccctcatcgcaaaggaggatggtatcgtgcagctcattaagcag
cccggtgccactctggaggctggtgatatcctcggtatcctcgctctggatgacccctcc
cgcgtcaagcacgcccagcccttcactggtcagctgcccgagcttggatcgcctaccgtc
cttggtaataagccctcccagcgcttcttcctgctccacagcattctggagaacattctt
cgtggtttcgacaaccaggttatcatgggtaccactttgaaggaccttgttgaggtgctg
cgcaaccctgaccttccctacggagagtggaatgcgcagtcttctgcgctgcactctcgc
attcctcagaagctggatgcgcagctccagaacgtggttgaccgtgccaaggcccgcaag
gccgagttccctgccaagcagctccagaaggccatcgttcgcttcatcgaggagcacatc
ggccctgccgatgctgagctgctcaagaccaccctcttgcccctggttcaggtcatcaac
aagtacatggacggtttgaagtccaacgagtataatgttttcattggcttgctggagcag
tactacgatgttgagaagctgttttccacccataacctccgcgacgaggatgtcattctc
aagctccgtgaggagaacaaggacgacattaccggcattgtccacactgttctctcccac
agccgcatcggttcgaagaacaacctggtcctggctattttggacatgtaccgccccaac
cagccccacctggagaatgtcggcacatacttcaagcctatcctcaagaagttgaccgag
ctcgagtctcgttcttccgccaaggtcactctcaaggcccgcgaggttcttattcagtgc
gctatgccatctctggacgagcgcctgtcgcagatggagcacattctgcggtcttccgtt
gttgagtctcgctacggcgagaccggatgggagcaccgtgagccttccttggatgtcttg
aaggaggttgttgactcgaagtacactgttttcgatgttcttcctcggttcttcgtccac
gctgacccctgggtcaccctcgcctccctggaagtttacgttcgtcgtgcctaccgtgca
tacacccttaagagcatcgactacaacgcctccactgagcagcctttcctgtcttgggac
ttcacccttggcaagcttggccagcgcgagttcggtgttcttaactccacccagccctcc
gccccgggcactcccattgcggaggtcaaccccttcaagcggatcaactccatcggcgac
atgtccctctttgtgagtgacgctgccagtgaccccgttcgcaaaggtgttattatcccc
gtgcaatacctggaggatgctgaggagatcctctgcaaggctctcgaggtcttccctgtc
ggcggctcgaacgccaagtgccccagtgagcagggcctcattgctaccctcgaaggcaag
cgtcgtcccgcccctaagcccgtgagtgacagcgagctcaccggagtctgcaacattgcc
attcgcgatatcgaagacatggaagatgcagatcttgttgcgcagatgaagcagctgctc
gccgacaacaaggatgagctcctcgcccgccgtattcgccgtgttaccttcatctgcggc
aagcaaggtgtctaccccggctacttcaccttccgtggtcccaactacgaggaggatctg
agtatccgccacagcgagccagctcttgccttccagcttgaactcggccgtctgtccaag
ttcaacatcaagcccgtcttcaccgagaaccgtaacatccacgtctacgaggctattggc
aagggccctgagaatgataaggctattgacaagcgctacttcgtccgtgctgtggtccgt
cccggccgtctacgtgacgatatccccaccgctgagtacttgatctcggaggccgaccgc
ctcatgaatgacatcttggatgccctggagatcattggcaacaacaactccgacctgaac
cacatcttcatcaacttctctcccgtcttcaacctccagcccgtcgatgtcgagcaagcc
ctggccggtttcctcgatcgcttcggccgccgtctgtggcgcctccgtgtcaccggcgca
gagatccgcatcctttgcaccgaccccgctaccggaatgccttaccccctgcgtgtgatt
atcagcaacacctacggtttcatcatcaacgtcgagctgtacattgagcgcaagtccgag
aagggcgagtggatcttccagagcattggtggtaccgccaagctgggctctatgcatttg
cgccctgtctccaccccctaccctaccaaggagtggctgcagcccaagcgctacaaggct
cacttgatgggaactcagtacgtgtacgatttccccgagcttttccgccaggcattccaa
aacagctggaccaagattgccgagaagattccttccttgtacgagaagcgccccccagtt
ggagagtgcattgactacagcgagctggtcttggatgacaccgacaaccttgttgaagtg
tctcgcgagcccggtaccaacactcacggtatggttggttggatcatcactgcccgtact
cccgagtacccccgcggcagacgtttcatcattgtcgccaacgacatcaccttccagatt
ggttccttcggtcctcaggaagacaggttcttccacaagtgcactgagcttgcccgcaag
ctgggtattccccgtatctacctgtctgctaactccggtgcccgcatcggtgttgcggat
gagctgattcccttcttctcggttgcctggaacaacccggagaagcccgaggccggcttc
aagtacctttacctcactcccgaggtcaagaagcgcttcgatgccagcaagaagaaggag
gtcatcaccgagctcgtcaatgacgacggtgaggagcgccacaagattaccaccgtcatc
ggtgccaaggacggtcttggtgttgagtgtctgaagggttccggtctcattgccggtgcc
acctccaaggcttacgaggacatcttcaccatcactctcgttacctgccgctctgtcggt
atcggtgcttaccttgtgcgtctcggtcagcgtgccatccaggttgagggccagcccatc
atcctcactggtgcccctgccatcaacaagctgcttggtcgcgaggtttacacctccaac
cttcagcttggtggcacccagatcatgtacaagaacggtgtttctcacatgactgccaac
gacgacttcgcgggtgttgagaagattgtcgagtggatgtctttcgtccctgacaagaag
aatgctcctatcccgattcgcccctggtcggacacctgggaccgtgacgttgcctacttc
ccacctcccaagcagacttatgatgtcagatggctcatcggtggtaaggaggacgttgac
ggcttccttcctggtcttttcgacaagggttccttcgaggaggcccttggtggctgggct
cgcaccgtcgttgtcggtcgtgcccgtcttggtggtatccccatgggtgtgatcgccgtc
gagacccgctcggtggagaatgtcactcctgccgatcctgccaatcccgactctatggag
atgatcgccaccgaggctggtggtgtctggtaccccaactcggcctacaagaccgcccag
gctctgcgcgacttcaacaacggcgagcagctgcccgtcatgatcctggctaactggaga
ggattctccggtggccagcgtgacatgtacaacgaggtcctcaagtacggttcgtacatt
gtcgacgctctcgtcaagtacgagcagcccatcttcgtgtacattcctcctcacggcgag
ctccgcggtggatcttgggtcgtcgttgaccccaccatcaaccccgaccagatggagatg
tacgccgacgaagactcccgcggtggtgtcctcgagcccgagggtatggtgaacatcaag
taccgccgcgagaagcagctggacactatggcccgtctggacgcgacctacggcgaactc
cgccgctccctggccgacacctcccttaccaacgagcagctcagcgaggtcaaggcgaag
atggccgcccgcgaggagcagctcctgcccgtgtacatgcagattgcgctgcaattcgcc
gacctgcacgaccgcgccggccgcatgcaagccaaggacactatccgcaagcctctgcag
tgggtcaactcccgtcgcttcttctactggcgtctgcgtcgccgtctcagtgaagagacc
atcgtcaagcgcatggtcgccgcctcggcacccgcagcctctggcgtcggcgctaccggc
gaatccctgcgcactgcccatctccgcaccctgcacgcctggactggactgctggatgag
gagctcgagcacgatgaccacaaggtcgctacttggtacgaggagaacaagaaggttgtg
cagagcaaggttgagtcgctgcgcactgatggcgttgcgtctgaggttgctcagctgctt
attggcaacaaggagggtggtctgcgcggtgtgcagcaggtgctttccatgttgcctgtt
gaggaacgtgaaaatgtgctgaagtaccttggttctgcttag

DBGET integrated database retrieval system