KEGG   Penicillium chrysogenum: Pc13g04030Help
Entry
Pc13g04030        CDS       T01091                                 

Definition
Pc13g04030
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
pcs  Penicillium chrysogenum
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Pc13g04030
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    Pc13g04030
   04113 Meiosis - yeast
    Pc13g04030
Protein phosphatases and associated proteins [BR:pcs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Pc13g04030
Ubiquitin system [BR:pcs04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     Pc13g04030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 808 aa AA seqDB search
MALSTGHVASQLRHLIYYQLDNNLIRNALFLASRLHAYEPRSFEAQFLLALCHLHNGEVK
AAFECSQASGSRGLHAGCAYVFAQACLDLGKYLDGVTALERSKSLWASKNHWNKHSETQR
QHLPDAAAVYSLQGKLWHAHKDLTKAVDCYVEALKLNPFMWDAFLGLCETGVNIRVPNIF
QLSPELLAIISSSPEEIATAPDNVAYEEGTFPVQPPGNPESDPFMVSASRGESDATFGSS
ALWEKLNGSSANFAAIAQPVFHDGMETPGAQSSGSDDFRIANGVTDPEAGWEAPLAPARK
TRTIQTMSLDHTGQPPPRMRPTGIRPRHKTRTEPETQPTAPVERDPSLVSRFGDRKRTVS
GQVAHPLPSSQPTEPGAPQRRSVRLFNQIKPTTSKLSNGTLTGRDGREMKKLRGGPTKGR
AGSAPTVGRVVSGNRKPVETPDNDGKDNRTGLSQSHSTAPPLPKNAEKTKELEALDWLLG
LFNKLASGYFALSRYKCADAISSFNSLSQGQRETPWVLSQLGRTYFEQASYTEAAKYFSR
VQKLAPSRIEDMEIYSTVLWHLKSDVELAYLAHQLLEADRLSPQAWCAIGNSFSHQRDHD
QALKCFKRATMLDPGFAYAFTLQGHEYVANEEYDKALEAYRHGINADNRHYNAWYGLGTV
YDKMGKLDFAEQHFRNAASINPTNAVLICCIGLVLEKMNNPQDALVHYGRASSLAPHSVL
AKFRKARVLMKLREYKFALAELKVLKDMAPDEANVHYLLGKLYKMLHDKANAIKHFTAAL
NLDPKAAQYIKDAMESLDDDDMEDEDIA
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggccttgtccaccgggcatgttgccagccagctacggcacctcatctattaccaactc
gacaataacttaattcgcaatgcgcttttcctcgcttcccgcctccacgcctatgaaccg
cgatcctttgaggcccaatttctgctcgccctttgccatctacacaacggagaagtgaag
gcagcatttgaatgcagccaggcttcgggctcgcgtggtctgcatgctggctgtgcttat
gtctttgctcaggcttgcttggacttgggaaaatacttggatggtgttactgctctggag
cgcagtaaatctctctgggcctccaagaaccactggaacaagcatagtgaaactcagcga
cagcacctgcctgatgctgctgccgtttactctctgcaggggaagctttggcacgcacac
aaagatttgaccaaagcagttgactgctatgtggaggctctcaaattgaaccccttcatg
tgggacgcattcctggggctttgcgaaacaggtgtcaatattcgagtcccaaatatcttc
cagctcagcccagaacttcttgcaataatatcttcgtcgccggaggaaatagctactgcg
ccagacaatgtggcttatgaagaagggaccttccctgtgcagcctcctggtaaccctgaa
tctgacccttttatggtctctgcctcgcgtggcgagtctgacgccacatttgggagctct
gctctctgggagaagctaaatgggagctccgccaattttgctgctatcgcacagccggtg
ttccacgacggaatggaaaccccaggtgcacagagcagtggctctgatgacttccgcatt
gcgaatggcgtcactgacccagaagctggatgggaagcacccttggccccagcccgaaag
acgcggacaatccaaactatgagccttgaccataccgggcaacctcctccgcgaatgcgt
ccaacaggcatcagacctcgacacaaaacacgaaccgaaccagagacccagccgactgct
cccgtagaaagggatccctctcttgtatcaagatttggcgaccgaaaacgcacagtctct
ggtcaagtcgcacatccccttccttcgtcacaaccaacggaaccaggtgctccacagcgc
cgaagtgttcgacttttcaaccagatcaaacctacaaccagcaagctttccaacggcacg
cttactggcagagatggccgcgagatgaagaagttaagaggtgggcctacgaaaggacgg
gcaggaagtgcgcccactgtcggccgtgtcgtgagtggcaatcgaaaaccggtggagaca
cccgacaatgacggtaaagataatcggactggcttgtcgcaatcccactctactgctccc
ccattacccaaaaatgctgaaaaaaccaaagagctcgaagccttggattggcttttgggt
cttttcaataaacttgcatctggatatttcgcattgagccgttacaagtgtgccgacgcc
atcagctctttcaattctctctcccaagggcagcgtgaaaccccttgggttttgtctcaa
cttggacggacctatttcgaacaagcaagctacacggaagctgccaagtacttttccagg
gtccaaaaattagcgccctcccgcattgaggatatggaaatctattcgactgttttatgg
catctgaaaagtgatgtagaactggcttacttggcccatcagctacttgaagctgatcgc
ctgtcccctcaggcgtggtgtgctattggcaactctttctctcatcaacgggatcacgat
caagcactcaagtgcttcaagcgtgcgaccatgctcgatcctggatttgcatatgctttc
acgctacagggacatgaatatgtcgctaacgaagaatatgacaaggcgttggaggcctat
cgccacggaatcaacgctgataatcgacattacaatgcttggtatgggctggggacggtg
tacgataagatgggcaagctcgacttcgctgagcagcatttccgcaatgcagccagcatc
aacccgacgaatgcggtgctcatttgctgcattggtctggttttggaaaaaatgaacaat
ccccaagatgcgctggttcactacggtcgagcctcctcgctagccccccactcggtatta
gccaagttccgcaaggcgcgcgtgctcatgaagctgcgcgaatacaagtttgctttggcg
gaattgaaggtcctgaaggacatggcgccagatgaagcaaatgtgcattaccttcttggg
aagctttacaaaatgctccacgacaaggccaatgctatcaagcatttcacggcggccttg
aacttggatccaaaggcagcacaatacatcaaggacgcaatggagtcgttggacgacgac
gatatggaggatgaggacatagcgtag

DBGET integrated database retrieval system