KEGG   Penicillium chrysogenum: Pc13g04030Help
Entry
Pc13g04030        CDS       T01091                                 

Definition
Pc13g04030
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
pcs  Penicillium chrysogenum
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:pcs04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:pcs04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:pcs04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 808 aa AA seqDB search
MALSTGHVASQLRHLIYYQLDNNLIRNALFLASRLHAYEPRSFEAQFLLALCHLHNGEVK
AAFECSQASGSRGLHAGCAYVFAQACLDLGKYLDGVTALERSKSLWASKNHWNKHSETQR
QHLPDAAAVYSLQGKLWHAHKDLTKAVDCYVEALKLNPFMWDAFLGLCETGVNIRVPNIF
QLSPELLAIISSSPEEIATAPDNVAYEEGTFPVQPPGNPESDPFMVSASRGESDATFGSS
ALWEKLNGSSANFAAIAQPVFHDGMETPGAQSSGSDDFRIANGVTDPEAGWEAPLAPARK
TRTIQTMSLDHTGQPPPRMRPTGIRPRHKTRTEPETQPTAPVERDPSLVSRFGDRKRTVS
GQVAHPLPSSQPTEPGAPQRRSVRLFNQIKPTTSKLSNGTLTGRDGREMKKLRGGPTKGR
AGSAPTVGRVVSGNRKPVETPDNDGKDNRTGLSQSHSTAPPLPKNAEKTKELEALDWLLG
LFNKLASGYFALSRYKCADAISSFNSLSQGQRETPWVLSQLGRTYFEQASYTEAAKYFSR
VQKLAPSRIEDMEIYSTVLWHLKSDVELAYLAHQLLEADRLSPQAWCAIGNSFSHQRDHD
QALKCFKRATMLDPGFAYAFTLQGHEYVANEEYDKALEAYRHGINADNRHYNAWYGLGTV
YDKMGKLDFAEQHFRNAASINPTNAVLICCIGLVLEKMNNPQDALVHYGRASSLAPHSVL
AKFRKARVLMKLREYKFALAELKVLKDMAPDEANVHYLLGKLYKMLHDKANAIKHFTAAL
NLDPKAAQYIKDAMESLDDDDMEDEDIA
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggccttgtccaccgggcatgttgccagccagctacggcacctcatctattaccaactc
gacaataacttaattcgcaatgcgcttttcctcgcttcccgcctccacgcctatgaaccg
cgatcctttgaggcccaatttctgctcgccctttgccatctacacaacggagaagtgaag
gcagcatttgaatgcagccaggcttcgggctcgcgtggtctgcatgctggctgtgcttat
gtctttgctcaggcttgcttggacttgggaaaatacttggatggtgttactgctctggag
cgcagtaaatctctctgggcctccaagaaccactggaacaagcatagtgaaactcagcga
cagcacctgcctgatgctgctgccgtttactctctgcaggggaagctttggcacgcacac
aaagatttgaccaaagcagttgactgctatgtggaggctctcaaattgaaccccttcatg
tgggacgcattcctggggctttgcgaaacaggtgtcaatattcgagtcccaaatatcttc
cagctcagcccagaacttcttgcaataatatcttcgtcgccggaggaaatagctactgcg
ccagacaatgtggcttatgaagaagggaccttccctgtgcagcctcctggtaaccctgaa
tctgacccttttatggtctctgcctcgcgtggcgagtctgacgccacatttgggagctct
gctctctgggagaagctaaatgggagctccgccaattttgctgctatcgcacagccggtg
ttccacgacggaatggaaaccccaggtgcacagagcagtggctctgatgacttccgcatt
gcgaatggcgtcactgacccagaagctggatgggaagcacccttggccccagcccgaaag
acgcggacaatccaaactatgagccttgaccataccgggcaacctcctccgcgaatgcgt
ccaacaggcatcagacctcgacacaaaacacgaaccgaaccagagacccagccgactgct
cccgtagaaagggatccctctcttgtatcaagatttggcgaccgaaaacgcacagtctct
ggtcaagtcgcacatccccttccttcgtcacaaccaacggaaccaggtgctccacagcgc
cgaagtgttcgacttttcaaccagatcaaacctacaaccagcaagctttccaacggcacg
cttactggcagagatggccgcgagatgaagaagttaagaggtgggcctacgaaaggacgg
gcaggaagtgcgcccactgtcggccgtgtcgtgagtggcaatcgaaaaccggtggagaca
cccgacaatgacggtaaagataatcggactggcttgtcgcaatcccactctactgctccc
ccattacccaaaaatgctgaaaaaaccaaagagctcgaagccttggattggcttttgggt
cttttcaataaacttgcatctggatatttcgcattgagccgttacaagtgtgccgacgcc
atcagctctttcaattctctctcccaagggcagcgtgaaaccccttgggttttgtctcaa
cttggacggacctatttcgaacaagcaagctacacggaagctgccaagtacttttccagg
gtccaaaaattagcgccctcccgcattgaggatatggaaatctattcgactgttttatgg
catctgaaaagtgatgtagaactggcttacttggcccatcagctacttgaagctgatcgc
ctgtcccctcaggcgtggtgtgctattggcaactctttctctcatcaacgggatcacgat
caagcactcaagtgcttcaagcgtgcgaccatgctcgatcctggatttgcatatgctttc
acgctacagggacatgaatatgtcgctaacgaagaatatgacaaggcgttggaggcctat
cgccacggaatcaacgctgataatcgacattacaatgcttggtatgggctggggacggtg
tacgataagatgggcaagctcgacttcgctgagcagcatttccgcaatgcagccagcatc
aacccgacgaatgcggtgctcatttgctgcattggtctggttttggaaaaaatgaacaat
ccccaagatgcgctggttcactacggtcgagcctcctcgctagccccccactcggtatta
gccaagttccgcaaggcgcgcgtgctcatgaagctgcgcgaatacaagtttgctttggcg
gaattgaaggtcctgaaggacatggcgccagatgaagcaaatgtgcattaccttcttggg
aagctttacaaaatgctccacgacaaggccaatgctatcaagcatttcacggcggccttg
aacttggatccaaaggcagcacaatacatcaaggacgcaatggagtcgttggacgacgac
gatatggaggatgaggacatagcgtag

DBGET integrated database retrieval system