KEGG   Penicillium chrysogenum: Pc13g04130Help
Entry
Pc13g04130        CDS       T01091                                 

Definition
Pc13g04130
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
pcs  Penicillium chrysogenum
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Pc13g04130
Enzymes [BR:pcs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Pc13g04130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 644 aa AA seqDB search
MPPKRARKSSPAAERRERLTLAKLASYDDVATDALVDHAYFWTTTRKNRTKYSPARGIHD
DDVGRILLEDVIVDKDIPKAERKLLELPGLKKYMTNLRSPREKEWFRRHLRKYIQMYLPD
CPFEVTTTNRYIITQHEAAICARRFIKKGEEIKHLSGTLVSMTHEEELDLGLTRKDFSIV
MSSRRRAPSFFLGPARFANHDCDANGSLTTRGNEGMSVLAMRDIHEGEEITVSYGEDYFG
IDNCECLCHTCEIAVRNGWSSHVDTETNSKESSPASEVTATEDTPAENSNVSRKRRRSSD
MEEPDSSSTLSCSTPRKRAKFQRQVSKLREEISVSELTGESGSAPPRGSDSTPIQDTVLI
SNALLAETAPQVVARRGDLNGTNGTNSTIPTDCESLSSTADQSHRSSTSTTPTTEDDIEP
QIKTEDTTLQPSESKALNGKDHPDASPEGQHITTHPMDIDPEEGLSDLSNSTKLDDDKVV
DKPKKRKPRTKRRFIVDSVETESQVARFPGDYTKTPRLLAQKYDRWVECQTCDTWFLQSN
SYLTRRECPRCERHSKLYGFQWPSTDKGPDGEERVMDHRTIHRFLSPDAQSRICRRDRGV
SFGITPTPELSDTNTPETETSDVTESRRDARATRRRTRELRMTM
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgcccccaaagagagcgcgaaagagctcgcccgccgcggaacgtcgcgagcgcttgacc
ctggctaaactggccagctatgacgacgtcgcaaccgatgcgctagtggatcacgcttat
ttttggaccactacccgcaagaaccgcaccaagtacagccctgcccgcggaatccacgat
gatgatgttgggcgcattcttctggaagatgttattgtggacaaagatattccaaaggcc
gaacgcaagctgcttgagttaccaggattaaagaaatacatgacaaacctccggagccct
cgagagaaagagtggttccgccgacacctccgcaagtacattcagatgtatcttccagac
tgtccgtttgaggtcaccacgaccaatcgatacatcatcacgcaacatgaagctgcgata
tgtgctcgcaggtttataaaaaagggcgaggagatcaaacacctgagtggaacgcttgtg
tctatgacccacgaggaagagttggatctcggcttgacccgcaaagacttcagcatcgtg
atgtcaagtcgtcgcagagccccatcgttcttcctgggtcctgctcgatttgccaatcat
gactgcgatgccaatggcagcttgacaactaggggcaatgagggcatgtctgtcctagcc
atgcgcgacattcacgagggagaagagatcaccgtttcctacggagaggattacttcggt
attgacaactgcgagtgtttatgtcatacttgcgagattgctgtacggaatggctggtcg
tcgcatgttgacacagagacgaacagcaaagagtccagtcccgcgtctgaagtcacagca
actgaagatacaccggctgaaaatagcaatgtgagcaggaaacgtagacgcagctcggac
atggaggaacccgacagctcctctaccttgtcttgttctactcctcgcaaacgtgcaaag
ttccaacgacaagtttctaagttgcgagaagagatctcagtttctgaacttactggggaa
tcaggatcagctccaccgcgcggatcggacagcactcctatacaggacactgtactgatc
tccaatgctcttctggcggaaactgcaccccaggtagtggctcgccgaggcgatctaaat
gggacaaatggcactaattctactattcccacggactgcgaatctctaagttccaccgcc
gatcaatcccaccggtcgtcgacgtcaactacccctacaactgaggatgacattgaaccc
cagatcaagacggaagacactacgctacaaccgtctgagtcgaaagcactcaacggtaag
gatcatcccgatgcctctcctgaaggtcaacacatcaccacccaccccatggacattgac
cccgaagaaggattgtcagacttatcaaattccaccaaattagacgacgataaggttgtg
gataagcccaaaaagcgaaagcctcgtaccaagcggcgcttcattgtagactccgtcgag
accgagtcacaggttgcccgattccctggagactataccaagacaccacgattgcttgct
cagaagtatgaccgctgggtggagtgtcagacctgtgatacatggttcctccagtcaaac
tcgtacctcacgcggcgtgaatgtccacgctgtgaacgccattccaagctgtacggattc
cagtggccatcaacggacaaaggcccggacggcgaagagcgagtaatggatcaccgcacc
atccatcggtttttgtcccccgatgcacaatcacgtatctgccgccgagaccgcggcgtt
agttttgggatcacccccacccccgagctctctgacacaaacaccccagaaacggagacc
agtgatgtaactgagtctcgccgggatgctcgggcaactcggcgtcgcactagagaactt
cgtatgactatgtaa

DBGET integrated database retrieval system