KEGG   Penicillium chrysogenum: Pc13g06360Help
Entry
Pc13g06360        CDS       T01091                                 

Definition
Pc13g06360
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pcs  Penicillium chrysogenum
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pcs00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 353 aa AA seqDB search
MTSSTPYAKELQLASLAVQRAAILTKEILSAVDKGALDKSDSSPVTIADFAAQASIIAAI
HNVFPDDDIVGEEDATALRTNPGLLARTWDLATGIHLDDPESEALLHTPRTTSELLDLID
LGAKGACTPTSRTWTLDPVDGTATFIRGEQYAVCLSLVENGVQKVGVLGCPNLLESGPVA
ERRVDRDGLGQMISAVAGQGATIRPMGLGALLPSRPLENVPQVGASGVRFIDTRAAKTQD
LEAHARVAANLGCPWPNPVDLWSAQMRYVAIAVQGGCNAFVKVPLSSEYRSKIWDHAGGM
LIVQELGCLVTDLEGKPVDCSQGRTLAGCHGMVVGPASVHGRILEAVREARGF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacctcttcaaccccatacgccaaagagcttcaactcgccagcctagccgtacaacga
gcagccatcttaacgaaagagatcctctctgctgttgacaaaggcgcccttgacaagagt
gactcctcacccgtaacaattgcggacttcgccgcccaagcctcaataattgcagccatt
cacaacgtcttcccagacgacgacatcgtcggcgaagaagacgccacagccctccgcaca
aacccaggcctcctcgcgagaacctgggacttagcaaccggcattcacctcgatgaccca
gaaagcgaagccctgctccacaccccacgtaccacctccgaactcctcgacctaatcgac
ctcggtgcaaaaggcgcctgcacccccaccagcaggacctggactctagaccccgtagac
ggaacagcaaccttcatccgcggtgaacagtacgcagtgtgtctatcactagtcgaaaat
ggagttcagaaagtcggcgtcctcggctgccccaatctcctggaatcggggcccgtcgct
gaacgccgcgttgaccgcgacggtctcggccagatgatctcagccgttgccgggcagggc
gctaccatcagacctatgggtctgggcgctttgctgccgtcgcgcccgctcgaaaatgtc
ccgcaggttggagcctctggcgtgcggtttattgatactcgtgcggcgaagacgcaggat
cttgaggctcatgcccgtgtggcggcgaatcttggctgtccgtggccgaacccggttgat
ttatggtcggcgcaaatgcgttatgttgctattgccgtgcagggagggtgtaatgctttc
gttaaggtgccgctaagttcggaatatcgctcgaaaatttgggatcatgcgggtggcatg
cttattgtgcaggaattgggctgccttgttacggaccttgagggaaagccggtggattgt
tcgcagggtcggactttggctgggtgtcatggtatggttgttgggccggcttcggttcat
gggaggattttggaggctgtgagggaggcgcggggattttga

DBGET integrated database retrieval system