KEGG   Penicillium chrysogenum: Pc13g06360Help
Entry
Pc13g06360        CDS       T01091                                 

Definition
Pc13g06360
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pcs  Penicillium chrysogenum
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Pc13g06360
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Pc13g06360
Transfer RNA biogenesis [BR:pcs03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Pc13g06360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 353 aa AA seqDB search
MTSSTPYAKELQLASLAVQRAAILTKEILSAVDKGALDKSDSSPVTIADFAAQASIIAAI
HNVFPDDDIVGEEDATALRTNPGLLARTWDLATGIHLDDPESEALLHTPRTTSELLDLID
LGAKGACTPTSRTWTLDPVDGTATFIRGEQYAVCLSLVENGVQKVGVLGCPNLLESGPVA
ERRVDRDGLGQMISAVAGQGATIRPMGLGALLPSRPLENVPQVGASGVRFIDTRAAKTQD
LEAHARVAANLGCPWPNPVDLWSAQMRYVAIAVQGGCNAFVKVPLSSEYRSKIWDHAGGM
LIVQELGCLVTDLEGKPVDCSQGRTLAGCHGMVVGPASVHGRILEAVREARGF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacctcttcaaccccatacgccaaagagcttcaactcgccagcctagccgtacaacga
gcagccatcttaacgaaagagatcctctctgctgttgacaaaggcgcccttgacaagagt
gactcctcacccgtaacaattgcggacttcgccgcccaagcctcaataattgcagccatt
cacaacgtcttcccagacgacgacatcgtcggcgaagaagacgccacagccctccgcaca
aacccaggcctcctcgcgagaacctgggacttagcaaccggcattcacctcgatgaccca
gaaagcgaagccctgctccacaccccacgtaccacctccgaactcctcgacctaatcgac
ctcggtgcaaaaggcgcctgcacccccaccagcaggacctggactctagaccccgtagac
ggaacagcaaccttcatccgcggtgaacagtacgcagtgtgtctatcactagtcgaaaat
ggagttcagaaagtcggcgtcctcggctgccccaatctcctggaatcggggcccgtcgct
gaacgccgcgttgaccgcgacggtctcggccagatgatctcagccgttgccgggcagggc
gctaccatcagacctatgggtctgggcgctttgctgccgtcgcgcccgctcgaaaatgtc
ccgcaggttggagcctctggcgtgcggtttattgatactcgtgcggcgaagacgcaggat
cttgaggctcatgcccgtgtggcggcgaatcttggctgtccgtggccgaacccggttgat
ttatggtcggcgcaaatgcgttatgttgctattgccgtgcagggagggtgtaatgctttc
gttaaggtgccgctaagttcggaatatcgctcgaaaatttgggatcatgcgggtggcatg
cttattgtgcaggaattgggctgccttgttacggaccttgagggaaagccggtggattgt
tcgcagggtcggactttggctgggtgtcatggtatggttgttgggccggcttcggttcat
gggaggattttggaggctgtgagggaggcgcggggattttga

DBGET integrated database retrieval system