KEGG   Penicillium chrysogenum: Pc13g06540Help
Entry
Pc13g06540        CDS       T01091                                 

Definition
Pc13g06540
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
pcs  Penicillium chrysogenum
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Pc13g06540
  Replication and repair
   03420 Nucleotide excision repair
    Pc13g06540
Transcription machinery [BR:pcs03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Pc13g06540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 483 aa AA seqDB search
MTSATSRPLEYLEGLPGTTFYKLYQQPSTALAIFRRMLPDLVNVAKCFVMALLYLKDPLP
TADLEVWVNSESKKERDNALSILGRLHILSTTLTGDNVRAYMITNPFAASLRQALTGAED
SHSFGVFSQAPEHTLTSITDLDEYARRQWEGVMGYMVGTSALSGQRDMVNLSKGVKQLLQ
AGHLVEIRGNRVDITKDGFGFVLQDVNTQVWHILILYVESAEAIGMDSVEVLSFLFLLSS
LELGSSYDKSHMTPNQLRTLMDLADFGIVYQEHADATRFYPTRLATTLTSDSSALSNPVT
GSLTGPAGPSGGSGSGFIIIETNYRLYAYTSSPLQISLISLFTNLKYRFPNLVTGKITRQ
SVRRAIEMGITADQIISYLLSHAHPQLRKHSAAQPNGKGVPASVLPPTVTDQIRLWQLER
DRLRATAGFLFKDFTSLAEYQAPCQYAAEIGVLVWKSDRKRMFFVTRHEQVAAFLRSQKV
GGK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcgcaacatcccgtcctctggagtacctggagggtctccccgggacaaccttt
tataagctataccaacagccatccacagcccttgcgatcttcaggcgcatgctgcccgat
ctagtgaatgtagcaaaatgctttgtgatggccctgctctatttaaaagatcctcttcca
acggctgatctggaagtttgggtcaactcagagagcaagaaggaacgagataatgcgctt
tcaatattaggtcgacttcatatcctttctacgaccctcacaggtgataacgtccgtgcg
tacatgatcaccaacccattcgctgcttcgcttcgacaagctttgacgggcgccgaggac
tctcattctttcggtgtattctcgcaagccccagaacacaccctgacctcgatcaccgat
ttggacgaatatgctagacggcagtgggaaggcgtcatggggtacatggttggaacgagt
gccttgagtgggcagcgtgacatggtcaatttgagcaagggtgtcaaacagcttctccaa
gcgggacacctagttgagattcgaggcaatcgtgtcgacattacgaaagacgggttcgga
tttgtgctacaggacgtgaatacccaggtctggcatatcttgattctttatgtcgagagc
gccgaggccatcggcatggatagcgttgaggttctctcgttcctgttcctcttgagcagt
ctggaactcggatcgtcttacgacaagagccatatgacacccaaccaacttcgcactctc
atggacctcgccgattttggtattgtctaccaagaacacgccgacgcgacacgtttctat
cccactcgtcttgcaactacacttacatccgactcgagcgctctgagcaaccctgtcaca
ggctccctgactgggccagcggggccgtctggcggctctggctccgggttcatcatcatc
gaaaccaactatcgactgtacgcctacacctcatcacccctacaaatatccctcatctcc
ctcttcacaaacctcaaataccgcttccccaatctggtcaccggcaagatcaccagacag
tctgtccgccgagccatcgagatgggaatcactgccgatcagatcatctcgtacctatta
tcgcacgcgcacccacagctgcggaagcacagcgctgcccaaccgaacggcaagggtgtc
ccggcatctgtactcccgcctaccgtgacagatcagatcagattgtggcagctggagcgg
gaccgtctccgggcgacggcgggctttttgttcaaggatttcaccagcttggccgaatat
caggctccttgccagtatgctgcggagattggcgtgctggtttggaagtcggaccggaag
cgcatgttttttgtcacgaggcatgagcaggtggctgcatttttgcggagtcaaaaggta
ggtgggaagtaa

DBGET integrated database retrieval system