KEGG   Penicillium chrysogenum: Pc13g07030Help
Entry
Pc13g07030        CDS       T01091                                 

Definition
Pc13g07030
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
pcs  Penicillium chrysogenum
Brite
Enzymes [BR:pcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Pc13g07030
Protein kinases [BR:pcs01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   Pc13g07030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 886 aa AA seqDB search
MDPGWQPYQDPLMGHPAQFNTALASHPQQLASKYGQPPQSQPPVGYTYETFQTPGTTSKA
PSAGSNSKTVSMASSPTATPRTRDYVTDADTTMEDADPYNRAKYPSRPNHNRASSQFLNQ
AEESSAARRYSPGNVLSPPMSYPTSPGKSQGSYGFPSAPQGASRRSPARPEYASPPQGYQ
SPPSTRPPRLPPLQSGDLSPNQYYPPSASSHMSPGFGPGSRSPRSGSLPSQAPPVPGRGP
VPKFQKIQSVQELKPRMNVQPAYRRANPEGGFISPLQSLTTHLPATYRICNPGFNYESSR
NPRRVLTKPSKGTKNDGYDNEDSDYILYVNDILGSEEAGHKNRYLILDVLGQGTFGQVVK
CQNLKTGEVVAVKVIKNKTAYFNQSMMEVSVLDLLNSKYDKNDDHHLLRLKDTFIHRQHL
CLAFELLSVNLYELIKQNQFRGLSTTLVRVFAQQLLNALSLLNKAHLIHCDLKPENILLK
NLESPIIKVIDFGSACDERQTVYTYIQSRFYRSPEVLLGLPYSSAIDMWSLGCIVVELFL
GLPLFPGSSEYNQICRIVEMLGIPPTWMLEMGKQSGEFFEKTQDEFGRKTYRLKSLEQYS
REHNTKEQPSKKYFSASTLEEIIRSYPMPRKNMKQAEIDRELNNRVAFIDFVRGLLSINP
LERWSPQQAKLHPFITQQKFTGPFMPPMNLKYSTANKPAPGVQQQQQAEAASKQRAAQAA
HAQNAYAVQMNQFHTPPQPQPQAPPMYNGMYQQGAPPPPYPTQQPPGYGHQMGMMPGNQV
PAQSLYAQATTRAGRQRASTMDPNGGIPTTIQRVASHLDPNAPIRLQPSPAYYPPPPDGY
VDANSSQRRRGSRAGNGNGNQRNRDFIRTLEDGVLSEGYMGQNQWH
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atggatcctgggtggcagccttaccaagatcctttgatgggccaccccgcgcagttcaat
actgcgttggcatctcatccccagcaacttgcctcgaaatacggtcagccaccacagtca
cagccgcccgttggatacacgtacgagactttccagacccccggcacgacatccaaagcc
ccttcggccggctcaaattccaaaacggtctccatggcttcctcccccaccgccacgcca
cgtactcgggattatgtcaccgatgcggataccaccatggaggacgctgacccgtacaac
cgggcgaagtacccctcgaggccaaaccacaatcgcgcttcgtcacaattcttgaatcaa
gcagaggaatcatcggctgcccgcagatactctccggggaatgtcctttcgccgccgatg
tcgtatcccactagtcctggcaagtcccaaggctcctatggatttccgtctgcaccccag
ggtgcttctcgccggtcccctgcgagaccagaatatgcatcgccaccacaaggatatcaa
tcgccgccatccacccggccccctagactccctccccttcaatccggcgacctcagccca
aaccagtactacccgccatccgcatcttcacacatgagtccgggctttggtccagggtca
cgatctccgcgatctggctcgctaccatctcaggcccctccagtgcccggtcgcggtcca
gttcccaagtttcaaaagatccagtctgtgcaagaactgaagccgcgcatgaatgtacag
cccgcatatcggcgcgctaatccagagggcggattcatcagcccgcttcaatcgctgaca
acccacctcccggcaacctaccgcatatgcaaccctggcttcaactacgagtcctcgaga
aacccgcgacgagtattgaccaaacccagcaaaggaaccaagaatgatgggtatgacaat
gaggacagcgattatatcctttacgtcaacgatatccttggaagcgaggaagccggtcac
aaaaatcggtacctgattctcgatgttctaggtcaaggtaccttcggccaagtcgtgaaa
tgccagaacttgaaaacgggtgaagtagtggctgtcaaagtcatcaagaacaagactgcc
tacttcaaccagagtatgatggaagtttctgtgttggatctgctcaacagcaagtatgac
aagaatgacgaccatcacctgcttcgtctcaaggacacattcatccaccgtcagcatttg
tgtcttgcattcgaattgctcagcgttaatctttatgagctgatcaaacaaaaccaattc
cgtggattgagcactacccttgtccgggtatttgcccaacaactgctgaatgccttgagc
ttgttgaacaaagcgcatctgattcactgtgatttgaagccggagaatattcttctgaaa
aacctcgagagcccaatcatcaaggtcattgacttcggttctgcttgcgatgaacgccag
actgtctacacctacatccaatctcgattttaccgatccccagaagtgctattaggcctg
ccttactcatctgccattgacatgtggtctcttgggtgtatcgtggtggagctcttcctg
ggtctacctctgttccctggctcttcggagtacaatcaaatctgtcggatcgttgagatg
ctgggtatcccaccgacctggatgttggagatgggcaagcagtcgggagagttcttcgaa
aagacacaggacgagttcggaagaaagacgtaccgcctcaagagcctggagcagtattcc
cgagaacacaacacgaaggaacaaccgagcaagaagtatttctcagcctcaacactggag
gagatcatccggagttacccaatgcctcggaaaaatatgaagcaagcagagattgatcga
gaactgaacaatcgcgtcgctttcatcgacttcgtgcggggactcctgtcgatcaatcct
ctcgagcgatggtcaccccaacaagccaagctgcacccgttcatcacccagcagaagttc
acggggccgttcatgccaccaatgaaccttaagtattcgacggccaataagccggctccg
ggggttcaacaacaacagcaagccgaggccgctagcaaacaaagagcagctcaggcggcg
catgcacaaaatgcctatgccgtgcagatgaaccaattccatactccacctcagccccag
cctcaagccccgcccatgtacaatggcatgtaccagcaaggtgcaccgcctcctccgtac
cctacccagcagccgcctggctatggtcatcaaatgggaatgatgccaggcaaccaggtg
ccggctcagagtctctatgcacaggcgaccacacgagcaggccgtcaacgagcatccacc
atggaccctaacggaggaatcccgactaccattcaacgagttgcgagccacctggatccc
aacgcaccgattagattgcagccaagccctgcgtattatccacctcctcctgacgggtac
gtggatgctaattccagtcaacggcgtcgtggcagccgagcgggtaatgggaatgggaac
caacgcaatcgggatttcattcgcaccctcgaagacggtgtgctcagcgaaggatacatg
ggccagaatcaatggcactag

DBGET integrated database retrieval system