KEGG   Penicillium chrysogenum: Pc13g07220Help
Entry
Pc13g07220        CDS       T01091                                 

Definition
Pc13g07220
Orthology
K04646  
clathrin heavy chain
Organism
pcs  Penicillium chrysogenum
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Pc13g07220
Exosome [BR:pcs04147]
 Exosomal proteins
  Proteins found in most exosomes
   Pc13g07220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1669 aa AA seqDB search
MAPLPIKFTELVNLTSVGIPPASIGFTSCTLESDHYVCVRQKLDEESKPEVIIIDLKNNN
EVLRRPINADSAIMHWNKNIIALKAQGRTIQIFDLGARQKLKSANMNEDIVYWKWFSEKS
LGLVTDSAVYHWDVYDATQQNPVKVFDRLPNLSGCQIINYRVNAEEKWMVVVGISQQQGR
VVGSMQLYSKERGISQFIEGHAASFASITVEGSPLPHSLFTFAVRTQTGAKLQIAEIDHQ
EPNPRFQKKAVEVYFPQEAVNDFPVAMQVSSKYDVVYLVTKYGFIHLYDLETGTCIFMNR
ISSETIFTTSPDSEGAGLVGVNRKGQVLAVSVDETNIIQYLMENPAMSGLAVKLASKAGL
PGADHLYQQQFDSLMASQDYAEAAKIAANSPRGFLRTLETINRFKSAPQTGQMSVILQYF
GMLLDKGSLNKYESVELVRPVLQQNRKHLLEKWMQEKKLESSEELGDIIRPYDMSLALTV
YLQANVPHKVVAGFAETGQFDKILAYSKQAGYQPDYTQLLQHIVRVNPEKGAEFATQLAN
EESGALVDLDRVVDVFLSQNMIQQATSFLLDALKDNKPEHGNLQTRLLEMNLHNAPQVAD
AILGNEIFTHFDRPRIAQLCEGAGLIQRALENSDDPAVIKRNIVRTDKLSPEWLMSYFGR
LSVEQTLDCMDTMLETNIRQNLQSVVQIATKFSDLLGANRLIDLFEKYRTAEGLYFYLGS
IVNLSEDSEVHFKYIEAATAMNQVTEVERICRESNYYNPEKVKNFLKEARLTEQLPLIIV
CDRFNFIHDLVLYLYQNQQFKSIEVYVQRVNPGRAPSVVGGLLDVDCDENIIKNLLSTVD
PSVIPIDELVTEVESRNRLKLLLPFLEATLATGNQQQAVYNALAKIYIDSNNDPEKFLKE
NDQYDTLTVGKYCEKRDPNLAYIAYSKGQNDLELISITNENSMFRAQARYLVERADPEIW
AFVLSENNEGRRSLVDQVIATAVPESTEPEKVSVAVKSFLDADLPGELIELLEKIILEPS
PFSDNTSLQNLLMLTAAKADKSRLMDYIHQLNDFSADEIAEMCTSVGLYEEAFEIYKKVN
NYLAAVNVLVENIVSIDRAQEFAERVELSEVWSKVAKAQLDGLRVTDSIESYIRAEDPSN
YHEVIETATHAGKDEDLVKFLRMARKTLREPAIDTALAFCFARLDQLAELEDFLRTTNVA
DIEASGDKAYAEGFHHAAKIFFTSISNWAKLATTLVHLEDYQAAVECARKANSVKVWKQV
NEACVEKKEFRLAQICGLNLIVHAEELQSLVRQYERNGYFDELIAVLEAGLGLERAHMGM
FTELGIALSKYHPDRVMEHLKLFWSRINIPKMIRASEEANLWPELVFLYCHYDEWDNAAL
AMMERAADAWEHHSFKDIVVKVANLEIYYRALNFYLQEQPLLLTDLLQVLTARIDVNRVV
RIFQSSDNIPLIKPFLLNVQSQNKRAVNDAINEILIEEEDHKLLKDSVDQNDNFDAVALA
QRLEKHDLIFFRQIAANIYRNNKRWEKSIALSKQDKLYKDAIETAAISAKPEVVEDLLRY
FVDIGSRECYVGMLYACYDLIRPDVIMEISWRKGLHDFTMPFMINFLCEQTRTIEMLKKD
NEERKNREKTTRTEEDNGPILQGSRLMLTQGPQSNGAGLTPQATGYRAF
NT seq 5010 nt NT seq  +upstreamnt  +downstreamnt
atggcacctctacctatcaagtttacagagttggtcaatttgacctctgtcggcattccg
ccggcatcaattggcttcacttcatgtacactagaatctgatcattacgtctgtgtccgt
caaaagctggacgaggagagcaaaccagaagtcatcattatcgacctcaagaacaacaat
gaagttctacgacgcccgatcaacgccgacagtgcgatcatgcattggaacaagaacatc
atcgctttgaaggctcagggccgtaccattcagatcttcgaccttggcgcgcggcaaaag
ctgaagtcggcgaatatgaatgaagatattgtctactggaagtggttcagcgaaaagtcc
ctcggtctggtcaccgactcagcggtctaccactgggatgtttacgacgccacacagcag
aaccccgtcaaggtgttcgaccgacttcccaacctttcagggtgccaaattatcaactac
cgcgtcaacgccgaggagaagtggatggtcgtggtcggtattagccagcagcagggccgg
gtcgttggatcgatgcagctttactcgaaagagcgcgggatctctcagtttatcgaaggt
cacgccgcctctttcgccagcattaccgtcgagggctcccccctaccccacagcctcttc
actttcgccgttcgtacccaaacgggcgccaagctgcaaatcgccgaaatcgaccaccaa
gaacccaaccctcgcttccagaagaaggccgtcgaggtgtacttcccacaggaggcggtc
aatgatttccccgtcgcaatgcaggtgtccagcaagtacgacgtggtttacctcgttacg
aaatacggtttcatccacctttacgatctcgagactggcacttgtatcttcatgaaccgc
atctccagcgagacgatctttaccacgtctccggattccgagggagccggcctggtcggt
gtgaaccgcaagggccaggtgctagccgtcagcgttgacgaaaccaatattattcagtac
ctcatggagaaccccgctatgtctggtcttgctgtcaaacttgcctcgaaggccggcctt
ccaggcgcggaccacctgtaccagcagcagtttgactctctcatggcctcacaggactac
gctgaggctgccaagattgccgccaactctcctcggggtttccttcgcactttggaaacc
atcaaccgtttcaagagcgctcctcaaaccggtcagatgtcggtgatcttacagtacttc
ggtatgctgctggacaagggttcgctcaacaagtacgaaagtgttgagcttgtccgaccc
gtcttgcagcagaaccgcaagcacttgcttgagaagtggatgcaggagaagaagctggag
agctcggaagagctcggtgacattatccggccatacgacatgtcccttgccctgaccgtt
tatctccaagctaatgtgcctcacaaggttgttgctggattcgcggagactggtcagttc
gacaagatccttgcatactccaagcaagctggatatcagccggactacacccagctgctt
cagcacattgttcgcgtaaaccccgagaagggcgcggagttcgctactcaactcgccaat
gaagaaagcggtgcattggttgaccttgaccgtgtcgtcgacgtgttcctgtcgcagaac
atgatccagcaggccacctcgttcctcctggacgctctgaaggacaacaagccagagcat
ggcaatctgcaaactcgtcttttggagatgaacctccacaacgccccgcaggttgcagac
gccatcctcggcaacgagattttcacacacttcgaccgtcctcgtatcgcccagctttgc
gagggtgccggtctcatccagcgtgctctggagaactccgatgatccagctgtcatcaag
cgcaacattgttcgcaccgacaagctgagccccgagtggctgatgagctacttcggtcgt
ttgtccgtggagcagactctcgactgtatggacactatgctggagacgaacattcgccag
aacctccagtctgtggtccagattgccaccaagttctccgatcttcttggcgctaaccgt
ctgattgatcttttcgagaaataccgcactgccgagggtctttacttctacttaggaagc
attgtcaacctcagcgaggactctgaagtgcactttaagtacattgaagctgctaccgcc
atgaaccaggtcaccgaggttgagcgtatttgccgtgagagcaactactacaaccccgag
aaggtgaagaacttcctgaaggaagcccgcctgacagagcagcttcccctgatcatcgtc
tgcgaccgtttcaactttatccacgatctggttctctacctctaccaaaaccaacagttc
aagtcgatcgaggtgtacgtccagcgcgtcaaccctggtcgtgccccttctgttgttggc
ggcttgctggatgttgactgtgatgagaacatcatcaagaatctgctctcaactgttgac
ccatccgtcatccccatcgacgagcttgttactgaggtcgagagccgaaaccgccttaag
ttgctcctgcctttcctcgaggccactctcgccactggcaaccagcagcaggcagtctac
aacgctctcgcgaagatctacattgacagcaacaacgacccggagaagttcctcaaggag
aacgaccagtacgacaccctcactgttggaaagtactgtgagaagcgtgatcccaacctg
gcgtacattgcctacagcaagggccagaacgacctggagctcattagcatcaccaatgag
aactccatgttccgtgcccaagctcgttacctcgtggagcgtgccgatcccgagatctgg
gcctttgtcctgagcgagaacaatgaaggccgacgttcccttgtggatcaggtcatcgcc
accgcagtgcccgaatctactgaacctgagaaggtgtctgttgccgtcaagtcgttcctt
gacgccgacctgcccggcgaactgattgagctgctcgagaagatcatcctggagccatct
cctttcagtgataacaccagcttgcagaacctcttgatgttgactgctgccaaggccgac
aagagtcgcctgatggactacattcaccagctcaacgacttctccgctgatgaaattgct
gagatgtgtaccagcgttggtctatacgaggaggcctttgaaatctacaagaaggttaac
aactacctggctgccgtcaacgtccttgtggagaacattgtcagcatcgaccgagctcaa
gaattcgctgagcgtgtcgagctgtccgaggtttggagcaaggtcgccaaggcccaactc
gatggtctccgcgtgactgactccattgaatcctacatccgtgccgaggacccgtccaac
taccacgaggtgattgagactgcaacccatgcaggcaaggacgaggatcttgtcaagttc
cttcgcatggcccgcaagaccctgcgtgagccggcgattgatactgctctcgctttctgc
tttgcccgcctggaccagctcgctgagctcgaggacttccttcgcactactaatgttgcg
gatattgaagcttctggtgacaaggcttatgctgaaggcttccatcacgctgctaagatt
ttcttcaccagcatctctaactgggccaagttggcgactaccttggttcacttggaggac
taccaggctgcagttgagtgtgcccgcaaggccaacagcgttaaggtctggaagcaggtc
aacgaggcctgtgttgagaagaaggaattccgtcttgcccagatttgcggtctcaacctg
attgttcacgctgaagagctgcagagccttgttcgtcagtacgagcgcaatggttacttc
gatgaattgatcgctgtcttggaggcaggtcttggcctcgagcgggctcacatgggtatg
ttcaccgagctcggcattgctctgtccaagtaccacccagaccgtgtcatggagcacctg
aagctcttctggtcccgcatcaacatccccaagatgatccgggcctcggaagaagccaat
ctctggccggagttggtgttcctgtactgccactacgacgagtgggacaacgccgctctt
gccatgatggagcgtgcagccgatgcctgggaacaccactcgttcaaggacattgtcgtc
aaggttgccaacctggagatctactaccgggcgctgaacttctaccttcaggagcagcct
cttctgctcactgacctgcttcaggttctgaccgctcgtatcgacgttaaccgtgtcgtc
cgcatcttccagagttctgacaatatccccctgatcaagcctttcctgctcaatgttcag
tctcagaacaagcgggctgtcaacgacgccatcaacgagattctgattgaggaggaggac
cacaagctgctcaaggactctgtcgaccagaacgacaactttgatgccgtggctctcgcc
cagcgccttgagaagcacgaccttattttcttccgccagattgcggccaacatttaccgc
aacaacaagcgctgggagaagtcgatcgcgctctccaagcaggacaagctctacaaagat
gctattgagaccgccgctatctccgctaagccagaggttgtggaggatcttctccgctac
ttcgtcgatatcggtagccgcgagtgctacgttggcatgctttatgcctgctacgacctc
atccgcccggacgtcatcatggagatctcatggcgcaagggtcttcacgacttcactatg
cccttcatgatcaacttcctctgcgagcagacccgaacgatcgagatgctcaagaaggac
aatgaggagcgcaagaaccgcgagaagacaacccgcacagaggaggacaacggtcccatc
ttgcagggctcgcggctcatgctgacacagggtcctcagtccaacggcgccggtctcaca
ccccaggcaactgggtatcgtgcattctag

DBGET integrated database retrieval system