KEGG   Penicillium chrysogenum: Pc13g11680Help
Entry
Pc13g11680        CDS       T01091                                 

Definition
Pc13g11680
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
pcs  Penicillium chrysogenum
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    Pc13g11680
Enzymes [BR:pcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Pc13g11680
Protein kinases [BR:pcs01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   Pc13g11680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 347 aa AA seqDB search
MAEFVRAQIFGTTFEITSRYTELQPVGMGAFGLVCSAKDQLTAQPVAVKKIMKPFSTPVL
SKRTYRELKLLKHLRHENVCTPLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQ
YFLYQILRGLKYVHSAGVVHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTRYY
RAPEIMLTWQKYDVEVDIWSAGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVIQ
TICSENTLRFVKSLPKRERQPLANKFKNADADAVDLLERMLVFNPKQRIQASEALAHEYL
APYHDPTDEPVSQEKFDWSFNDADLPVDTWKIMMYVLDLLPRHDSFN
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggcggaattcgtacgtgcccagattttcggcaccacctttgagatcaccagccggtat
acggaactgcagccggtgggaatgggtgccttcggactggtctgttctgccaaagaccaa
ttgaccgcacagccagtcgcagttaaaaagatcatgaaacccttcagtacccccgttctg
tccaagcgaacctaccgggagctgaagctgctcaagcatctccgtcacgagaacgtctgt
actcccttgagtgacattttcatttcgcctttggaagatatctacttcgtcaccgaactt
ctgggaactgacctccaccgacttcttacttcgcgacctcttgaaaagcagttcattcag
tacttcttataccagattctgcgtggtttgaaatatgttcactccgccggtgtggtccac
cgggatctgaaacccagtaacattctgattaacgagaactgcgatctgaaaatctgcgac
tttggtcttgcccgcatccaggacccccaaatgaccggatatgtctcaacacgatactac
cgcgcgcccgagatcatgctcacctggcaaaagtatgatgtcgaggtagacatctggagt
gcgggctgtatcttcgccgagatgttggaaggaaagccgctgttccccggaaaggaccat
gtcaaccagttttcgatcattacggagctacttgggactcccccagatgatgtgatccag
accatctgtagcgagaacaccctccgattcgtcaagtcactaccaaagcgcgagcgccaa
cccctcgcgaataaattcaagaacgccgatgccgatgcggttgatctgctcgagcggatg
ctggttttcaacccaaagcaacgcattcaagcttccgaagcattagcgcatgagtacctg
gcgccctaccatgacccgaccgacgagcctgtctcacaagagaagttcgattggtcgttc
aatgatgccgatctgcccgtagatacttggaagatcatgatgtacgtgcttgatttgtta
ccccgccacgattcttttaactaa

DBGET integrated database retrieval system