KEGG   Penicillium chrysogenum: Pc13g12130Help
Entry
Pc13g12130        CDS       T01091                                 

Definition
Pc13g12130
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
pcs  Penicillium chrysogenum
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Pc13g12130
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Pc13g12130
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Pc13g12130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1151 aa AA seqDB search
MAYATTTSPTLNADTQSNLKLATSPPQPTLHHVVTSLPSGPPPCSAPSFTSSPTSTPTSS
FPAPDTPYTFTPAGTPLQSASEGLYGRVNGPSLPMPGPLELGESMMAVPGSANPSSFNDA
AVSTKAPGLMRRISRGAANKLTRRRQSTTQNEKRDRSTGPIIMRRRSDSKTGTQPVRDSA
LDSSNEDEAGEALDNLGAWAGSEASSLRSESRMNMARETGPVPAVAVAPKIDSAVQRGTV
LTKVTKKRRKQVRFFLDLDAAKVFWDLSNPAKRFYIDDIKEIRVGADARNYREEHQVPED
LERRWFTIVIADSDRSKGRAVKTLHLIAPSDRILELWITTLEHISRYRIDLMSGLAGSGQ
SEAVLKAHWEREMSRLFPQRPPLEEQSLDLAAVEKVCRSLHINCSKNMLRAQFTKADAAC
NGKLDFSEFKDFLLRLKERKDVKDIFKLHTAKPKEGMTQEEFLAFLRHVQNEDIESDRVY
WATLFDKYVRRASKSRTPSAEGSELPPPVSRMNLDAFAAFLSSSSNGIYASRAPQSRFDR
PLNEYFISSSHNTYLLGRQVAGASSTEAYVSALQQGCRCVEIDCWDGADGRPIVSHGRTL
TTSVLFADCITVINRYAFITCDFPLILSLEVHCNPEQQLAMVKIMKETFKERLVLEPLMT
NCQILPSPEELKGRILVKVKTCDENEFDPRHNTVGSVGTHGRKRSSSTPFVRPTLHEANT
MPLPTLSRPSTIGPLDSIGPLISHDRRSLTATSMSSATDDSDGALATVHTDKKKKRRQKS
KITKPLSDLGVYTRGYKWHSFSSPESRRYNHIYSFAERSFESICQSHDNKVALESHNRKY
LTRVYPSGFRLRSSNFDPNKFWRRGVQMVALNWQTYDIGMQMNQAMFAAGTDRTGYILKP
ESLRLPAVDGNQKRKMERKLVRFSVDVVSAQQLPRPRTIGQDDSINPYVEIEMFSADDRG
QSFVLGEGGMNASARNGMSGIGYPHRRRTKIEQSNGYSPVFNDKFKLSLETKYPDLVFVR
WTVWSSTDGRSTGNSVQLATFTAKLTSLSQGYRYLPLYDASGDQYLFSTLFCKISKQDPI
SVQRLDLEELRAERMGILRHIGQTVFKRSSSAERERDQSQDRSDSPSPEDKEGCPNLTPT
VSTTSNSSFVQ
NT seq 3456 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgctacgactacctcaccgaccctgaatgctgacacccaatccaacttaaaa
cttgcgacatctccccctcaaccgactttacatcatgttgtcacatctttaccatctggc
cctcccccttgttccgcaccctcattcacctcttcgccgacctctacacccacctcatct
ttccctgctcccgacacaccctatactttcacccctgccggcactcccctgcaatctgcc
agcgagggactctacggccgagtaaacggcccttccctgcctatgccaggcccgcttgaa
ctcggcgagtccatgatggccgttcccggaagcgcaaatccgtccagcttcaatgacgct
gctgtgtccacgaaggcgccgggcttaatgagacgaatctcaagaggcgccgccaacaaa
cttactcgtaggaggcagtctacgacccaaaacgagaaacgagaccggagcactggtccc
atcatcatgcgccggcgcagtgacagcaaaaccggcacccaacctgttcgagatagcgcc
cttgattccagcaacgaggatgaagccggcgaagccttggacaacctgggtgcatgggct
ggttcggaggcatccagtcttcgcagcgaaagtcgtatgaatatggctcgcgaaactggt
cccgttcccgccgttgccgttgcgcccaaaatagactctgctgttcagcgaggcacagtc
ttaaccaaggtgaccaagaaacgcaggaagcaagttcgcttcttcctagacctagacgcc
gccaaggtgttctgggatctctccaacccggccaaacgcttctatatcgacgatatcaaa
gaaatccgagtcggtgccgacgctcgcaactatcgtgaagaacatcaggttcccgaagat
ttggagcgccgatggttcaccattgtcattgcggattctgaccgctctaagggccgagcg
gtcaaaacattgcacctcatcgctcctagcgaccgtattcttgagctgtggattaccacc
ctggagcatatctctcggtaccgaatcgatctgatgtctggtctggcaggttcgggccaa
agcgaagcggttctaaaggcacactgggagcgcgagatgtcgagactcttcccgcagcgt
cctccactggaggaacaaagcctcgacctcgctgccgtggagaaagtctgccgcagcttg
catatcaactgttccaagaacatgctccgggcacagttcactaaagctgacgctgcctgt
aacggcaaattggatttctctgaattcaaggatttccttttgcgtttgaaggaaagaaag
gatgtcaaagacatcttcaagcttcacaccgcaaaaccgaaggagggcatgacccaggag
gagttcttggctttccttcgtcatgtgcaaaatgaagatattgaatccgaccgggtttac
tgggctacactgttcgacaagtacgtccgacgggcctctaaatctcgcactccttctgca
gaaggatcggagcttcctccacctgtgtcgcggatgaacctggatgcattcgccgcgttc
ttatcttcgtccagcaacggtatctacgcttcacgtgctccccagtcgagattcgaccgc
ccgttgaatgaatacttcatctcgagctctcacaacacttatctccttggccgccaagtg
gctggtgcatcaagcactgaggcttacgttagcgcgcttcagcagggatgtcgttgtgtc
gaaatcgactgctgggatggcgcagatggacgccccatcgtgtcccatgggcggactctt
accaccagtgtcctcttcgcggattgcatcaccgtcatcaaccgatatgcttttatcaca
tgcgacttcccactcattctttctctcgaggtgcactgcaatccggaacagcaactggcg
atggttaagatcatgaaggagacattcaaggaacgacttgtccttgagcccttgatgacc
aactgccagatccttccgtctcctgaggagcttaagggtcgtatcctggtgaaagtgaag
acgtgtgacgagaacgagtttgatccccgccacaataccgtcggctctgtcggtacccac
ggccgcaaacgcagttctagtactccatttgtgcgaccgacgctccatgaggcaaacacc
atgcctcttcccacactctcaaggccctctacgataggtccgctcgacagtatcggccct
ttgatctcgcatgataggcgttcccttactgctacaagcatgagcagtgccaccgacgac
agtgacggagcgctagcgactgttcacaccgacaagaagaaaaagcgccgccagaaaagc
aagatcaccaagcctctctctgacttgggtgtgtacactcgtggctacaagtggcacagc
ttctcgtctccagagagcaggcggtataaccatatatactcgtttgccgaacggtctttc
gagagcatctgtcagagtcacgacaacaaggtcgcactggagtcacacaaccgcaagtac
ctaacgcgggtgtatccttccggattccgactccgttcatctaacttcgatccgaacaag
ttctggcgccgtggtgtgcaaatggtagcgctcaactggcaaacttacgacatcggcatg
caaatgaaccaggctatgtttgccgctggaaccgaccgcactggctacatcctcaagccc
gagagcctccgcttgccggctgttgatggaaatcagaagcgcaagatggagcgcaaacta
gttcgattctcggttgacgtcgtctcggcacaacaactcccccgtccgcgcaccattgga
caggatgacagcatcaacccttacgttgagatcgagatgttcagtgctgacgatcgcggt
caaagcttcgtcctcggcgaaggtggcatgaatgcctctgcgcgcaatggtatgtccggc
attggatatccgcaccgtcgccgcacaaagatcgagcaaagcaatggctacagccctgtt
ttcaatgacaagttcaagctgtcactggaaactaaatatcccgatcttgtatttgtgcga
tggacggtctggagctcaacggacggccgcagtacaggaaacagcgtgcagctggccact
ttcaccgccaagctcaccagcttgtcgcagggttaccgctacttgcctctctacgatgcc
agcggcgaccagtacttgttctcgactcttttctgcaagatctccaagcaagatcccatc
tccgttcagcgtctggacctcgaagagctccgcgccgaacgcatgggtattctgcgccac
atcggccagactgtcttcaagcgctcctcatcggccgagcgcgaaagggatcaatcacag
gatcgcagtgactctccaagccctgaggacaaggaaggctgtcctaacctgacacccact
gtctcaacaacgtcgaactcatcattcgtgcaatga

DBGET integrated database retrieval system