KEGG   Penicillium chrysogenum: Pc13g12290Help
Entry
Pc13g12290        CDS       T01091                                 

Gene name
trpC
Definition
anthranilate synthase multifunctional protein trpC-Penicillium chrysogenum
Orthology
K13501  
anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
pcs  Penicillium chrysogenum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pc13g12290 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pc13g12290 (trpC)
Enzymes [BR:pcs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Pc13g12290 (trpC)
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Pc13g12290 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Pc13g12290 (trpC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 752 aa AA seqDB search
MADLVDHSPHHATKAAKLASASNVILIDNYDSFTWNIYQYLVLEGATVTVYRNDEVTVED
LVAKKPTQLVISPGPGHPDTDAGISNAVIKHFSGKVPIFGVCMGQQCMITSFGGKVDVTG
EILHGKTSELKHDSKGVYQGLPTSLEVTRYHSLAGTHSTIPDCLEVTSRVELGDASGKNI
IMGVRHKEFAVEGVQFHPESILTQYGRKMFRNFLELTAGTWDNKQGAAVAAPADKKLSIL
DKIYAHRKNAVDEQKKIPALRPEALQAAYDLNIAPPQLSFPDRLRQSDYPLSLMAEIKRA
SPSKGIISANVCAPAQAREYAKAGASVISVLTEPEWFKGTIDDLRAVRQSLEGLPNRPAV
LRKEFVFEEYQILEARLAGADTVLLIVKMLDIELLTRLYHYSRSLGMEPLVEVNTPEEMK
IAVDLGSEVIGVNNRDLTSFEVDLGTTSRLMDQVPESTIVCALSGISGPQDVEAYKKEGV
KAILVGEALMRAPDTSAFVAQLLGGSNQNFAGASPSSPLVKICGTRTEEGALAAIQAGAD
LIGIIMVQGRSRLVPDDVALGISRVVKSTPRPADTLQQPSSATSLEWFDHSTNILRHPSR
ALLVGVFMNQPLSYVVSQQQKLGLDVVQLHGSEPLEWSSLIPVPVIRKFAPGDIGIARRA
YHTLPLLDSGAGGSGELLEESGVKKVLDSDEGLRVILAGGLNPDNVAGTVKKLGQSGQKV
VGLDVSSGVETNGAQDLEKIRAFVKSAKSIRQ
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccttgtcgaccactccccccaccatgccactaaagcggcaaaattggccagc
gcatccaacgtgattctgatcgacaactacgactcatttacctggaatatctatcaatac
cttgtccttgaaggtgctaccgtcacagtctatcgcaatgacgaagttactgttgaggac
ttggttgcaaagaagcccactcagctggttatcagtcctggccccggccacccggacacc
gatgcgggaatcagtaatgccgtaatcaaacatttcagtggaaaggttccgatctttggt
gtgtgcatgggtcagcaatgtatgatcacctcgtttggtggtaaggtggacgtgaccggc
gaaattctgcacgggaagacatcggagttgaagcatgactccaagggtgtctaccaggga
ttgccaacctcgctcgaggtcactcgctaccattcgctcgcggggacacactcgactatt
ccagattgcttggaagtgacttcgcgggtcgagcttggggacgctagtggcaagaacatc
attatgggagtcagacataaggagttcgcagtggagggtgttcagttccaccccgagagt
atcttgacacaatacgggcgcaagatgttcagaaacttcttggagctcaccgctgggact
tgggataacaagcagggagctgccgtcgccgcaccggcagacaagaagttatccattttg
gataagatctacgcccatcgcaaaaatgctgttgacgagcagaagaaaattccggctctg
cggccagaggctcttcaagccgcatatgatctgaacattgcgcctcctcaactgtcattc
cctgatcgcctgagacagtcagactatcctctctcactcatggcggagatcaaacgtgca
tcaccctcgaaaggcatcatctcggccaatgtgtgtgcccctgctcaagcacgggagtac
gccaaagctggcgctagcgtcatttctgtcctcacagagccggagtggttcaagggcacc
atagatgacctgcgggctgttcgccagagcctggagggacttcccaaccgaccagctgtc
ctccgaaaggagttcgtctttgaagagtaccagatcctggaggcacgtttggctggagct
gatacagttctgctgattgtgaaaatgctggacattgagctgttgactagactgtaccat
tactcgcgcagtcttggcatggagcctctggtcgaggttaatacccctgaagagatgaag
attgcagttgacctgggttccgaagtcatcggcgttaacaaccgagacctgacaagcttc
gaggtcgatctcgggacaactagtcgcctaatggatcaagtgcctgagagcacaattgtg
tgtgcccttagtggaatatcgggcccccaggatgtggaagcttataagaaagaaggcgtt
aaggcaattcttgttggagaggctcttatgagggcacctgatacctctgcctttgtggca
cagcttctcggcggttctaaccaaaattttgctggtgcatcaccaagttctccactggtg
aagatctgtggaacacggaccgaagaaggagctctggctgctatccaagctggcgcggat
ttgattggcatcattatggttcagggccgctcacggcttgtcccagatgatgttgctctc
ggaatttctcgggtggtcaagtcgacccctcgtccggccgatacattgcagcagccctca
agcgctacatcattggaatggttcgatcactccactaatattttgcgtcacccttctcgt
gctttgctcgtgggtgtgttcatgaaccagccgctatcatacgtcgtttctcaacaacag
aagttgggtctcgatgttgtgcaactgcacggatctgagccattggagtggtctagtttg
attccagttcctgtcattcgcaaattcgcccccggtgacattggaattgctcgcagagca
taccacactctcccattgctggactctggtgccgggggctctggcgaacttctggaggag
agtggtgtcaagaaggtcctcgatagcgacgagggcttgcgggttatcctggctggagga
ttaaatccggacaacgtggcaggcacagtgaaaaagctgggccagtcgggccagaaagtg
gttggcttggatgtcagctcaggtgtagagacaaatggcgctcaagatctggagaaaatt
cgagcctttgtcaagtctgccaaaagcattcggcaatga

DBGET integrated database retrieval system