KEGG   Penicillium rubens: Pc13g12290Help
Entry
Pc13g12290        CDS       T01091                                 

Gene name
trpC
Definition
(RefSeq) anthranilate synthase multifunctional protein trpC-Penicillium chrysogenum
  KO
K13501  anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
pcs  Penicillium rubens
Pathway
pcs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pcs01100  Metabolic pathways
pcs01110  Biosynthesis of secondary metabolites
pcs01130  Biosynthesis of antibiotics
pcs01230  Biosynthesis of amino acids
Module
pcs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pc13g12290 (trpC)
Enzymes [BR:pcs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Pc13g12290 (trpC)
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Pc13g12290 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Pc13g12290 (trpC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGPS PRAI GATase Peptidase_C26 QRPTase_C His_biosynth NanE
Motif
Other DBs
NCBI-GeneID: 8311663
NCBI-ProteinID: XP_002559645
UniProt: B6H5A3
AA seq 752 aa AA seqDB search
MADLVDHSPHHATKAAKLASASNVILIDNYDSFTWNIYQYLVLEGATVTVYRNDEVTVED
LVAKKPTQLVISPGPGHPDTDAGISNAVIKHFSGKVPIFGVCMGQQCMITSFGGKVDVTG
EILHGKTSELKHDSKGVYQGLPTSLEVTRYHSLAGTHSTIPDCLEVTSRVELGDASGKNI
IMGVRHKEFAVEGVQFHPESILTQYGRKMFRNFLELTAGTWDNKQGAAVAAPADKKLSIL
DKIYAHRKNAVDEQKKIPALRPEALQAAYDLNIAPPQLSFPDRLRQSDYPLSLMAEIKRA
SPSKGIISANVCAPAQAREYAKAGASVISVLTEPEWFKGTIDDLRAVRQSLEGLPNRPAV
LRKEFVFEEYQILEARLAGADTVLLIVKMLDIELLTRLYHYSRSLGMEPLVEVNTPEEMK
IAVDLGSEVIGVNNRDLTSFEVDLGTTSRLMDQVPESTIVCALSGISGPQDVEAYKKEGV
KAILVGEALMRAPDTSAFVAQLLGGSNQNFAGASPSSPLVKICGTRTEEGALAAIQAGAD
LIGIIMVQGRSRLVPDDVALGISRVVKSTPRPADTLQQPSSATSLEWFDHSTNILRHPSR
ALLVGVFMNQPLSYVVSQQQKLGLDVVQLHGSEPLEWSSLIPVPVIRKFAPGDIGIARRA
YHTLPLLDSGAGGSGELLEESGVKKVLDSDEGLRVILAGGLNPDNVAGTVKKLGQSGQKV
VGLDVSSGVETNGAQDLEKIRAFVKSAKSIRQ
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccttgtcgaccactccccccaccatgccactaaagcggcaaaattggccagc
gcatccaacgtgattctgatcgacaactacgactcatttacctggaatatctatcaatac
cttgtccttgaaggtgctaccgtcacagtctatcgcaatgacgaagttactgttgaggac
ttggttgcaaagaagcccactcagctggttatcagtcctggccccggccacccggacacc
gatgcgggaatcagtaatgccgtaatcaaacatttcagtggaaaggttccgatctttggt
gtgtgcatgggtcagcaatgtatgatcacctcgtttggtggtaaggtggacgtgaccggc
gaaattctgcacgggaagacatcggagttgaagcatgactccaagggtgtctaccaggga
ttgccaacctcgctcgaggtcactcgctaccattcgctcgcggggacacactcgactatt
ccagattgcttggaagtgacttcgcgggtcgagcttggggacgctagtggcaagaacatc
attatgggagtcagacataaggagttcgcagtggagggtgttcagttccaccccgagagt
atcttgacacaatacgggcgcaagatgttcagaaacttcttggagctcaccgctgggact
tgggataacaagcagggagctgccgtcgccgcaccggcagacaagaagttatccattttg
gataagatctacgcccatcgcaaaaatgctgttgacgagcagaagaaaattccggctctg
cggccagaggctcttcaagccgcatatgatctgaacattgcgcctcctcaactgtcattc
cctgatcgcctgagacagtcagactatcctctctcactcatggcggagatcaaacgtgca
tcaccctcgaaaggcatcatctcggccaatgtgtgtgcccctgctcaagcacgggagtac
gccaaagctggcgctagcgtcatttctgtcctcacagagccggagtggttcaagggcacc
atagatgacctgcgggctgttcgccagagcctggagggacttcccaaccgaccagctgtc
ctccgaaaggagttcgtctttgaagagtaccagatcctggaggcacgtttggctggagct
gatacagttctgctgattgtgaaaatgctggacattgagctgttgactagactgtaccat
tactcgcgcagtcttggcatggagcctctggtcgaggttaatacccctgaagagatgaag
attgcagttgacctgggttccgaagtcatcggcgttaacaaccgagacctgacaagcttc
gaggtcgatctcgggacaactagtcgcctaatggatcaagtgcctgagagcacaattgtg
tgtgcccttagtggaatatcgggcccccaggatgtggaagcttataagaaagaaggcgtt
aaggcaattcttgttggagaggctcttatgagggcacctgatacctctgcctttgtggca
cagcttctcggcggttctaaccaaaattttgctggtgcatcaccaagttctccactggtg
aagatctgtggaacacggaccgaagaaggagctctggctgctatccaagctggcgcggat
ttgattggcatcattatggttcagggccgctcacggcttgtcccagatgatgttgctctc
ggaatttctcgggtggtcaagtcgacccctcgtccggccgatacattgcagcagccctca
agcgctacatcattggaatggttcgatcactccactaatattttgcgtcacccttctcgt
gctttgctcgtgggtgtgttcatgaaccagccgctatcatacgtcgtttctcaacaacag
aagttgggtctcgatgttgtgcaactgcacggatctgagccattggagtggtctagtttg
attccagttcctgtcattcgcaaattcgcccccggtgacattggaattgctcgcagagca
taccacactctcccattgctggactctggtgccgggggctctggcgaacttctggaggag
agtggtgtcaagaaggtcctcgatagcgacgagggcttgcgggttatcctggctggagga
ttaaatccggacaacgtggcaggcacagtgaaaaagctgggccagtcgggccagaaagtg
gttggcttggatgtcagctcaggtgtagagacaaatggcgctcaagatctggagaaaatt
cgagcctttgtcaagtctgccaaaagcattcggcaatga

DBGET integrated database retrieval system