KEGG   Penicillium chrysogenum: Pc13g13560Help
Entry
Pc13g13560        CDS       T01091                                 

Definition
Pc13g13560
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
pcs  Penicillium chrysogenum
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pcs00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 492 aa AA seqDB search
MSSQDDSSEPHDTTLIVESVSSVSLTIGADSLLILDDRPAKADRSCCGLLQSKPETNHAI
SLYNILGAEVTASNLVIAYAQHSAKNDVSVTTVQYPISEKEKKAVERWAQQLLDVAYAKA
LRGKRLKILVNPFGGKGTAASLYQRYAAPVFAAAKCQLDVQNTEYSGHAIEIAENLDIDA
YDAVVCCSGDGLPYEVFNGLGKRPDARKALAQTAVALLPCGSGNGLTWNAFGTGSVSIAA
LAIVKGLRTPLDLVSISQKDSRMLSFLSQSFGIVAECDLGTENIRWMGAQRFTYGFLIRL
MRQTIWPCDIAIKVEIGDKESIKEHYTAWCTRPQEPDADSKRLELAAESPGLPELKYGTV
TDELPQGWQVISGETMGNFYAGNMAIMSKDTNMFPATLPDDGLMDVVTIDGTVSRATALT
MMNEIPSGRFFDMPDLNVRKASAFRLIPHQKEGYISIDGERVPFEAFQAEVHQGLGTILT
KSGRVYEAAGPR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcccaagacgactcctcggagccgcacgacacaacgctgatcgttgaatctgtc
tcatctgtctctttgactatcggcgctgactcgctcctcatacttgatgatcgcccggcc
aaagcagatcgtagctgctgcggattactccagtctaaaccggaaaccaaccatgccatc
tcattgtacaacatcctgggcgccgaagtcacggcttccaatctcgtgattgcctatgca
cagcattctgccaagaacgatgtttccgtaacaaccgtccaatacccaatctccgaaaaa
gaaaaaaaggccgtcgagagatgggcacaacaactgctcgatgtcgcgtatgcaaaggca
ctgcgcggcaaacggctgaagattttggtcaatcctttcggtgggaagggaactgctgca
agtttgtatcagcgatatgcggcgcctgtcttcgccgcggcgaagtgccagctggatgtg
cagaacacggaatacagtgggcatgcaattgaaattgcggaaaacctcgacatcgacgct
tacgatgcggtcgtttgctgctctggagacggcttgccctacgaggtgttcaatggattg
ggcaagcggccagatgctcgaaaagcgctagcgcagactgctgttgcactgcttccttgt
ggctctggaaatgggctgacatggaatgcttttgggactggtagcgtctcgattgcggcg
ctggcaatcgtcaaggggctgaggactccactggacctagtctcgatctctcagaaagat
tcgcgcatgctctctttcctctcgcaatcttttggcattgtcgccgagtgtgatttgggc
actgaaaacatccgttggatgggcgctcagcggtttacatacggctttttgatccgtttg
atgcgacagaccatatggccttgtgacatagccatcaaggtggaaattggcgacaaggag
tcaattaaggaacactacactgcgtggtgtacacgcccacaggagccggatgctgacagt
aaacgcctcgaacttgctgcagagtcaccaggcctaccagagctcaaatacggtacagtg
acggacgagctgccccagggatggcaggttatttcgggtgaaactatgggcaatttctac
gcagggaatatggccattatgtcgaaagacacaaatatgtttcctgcaacattgcccgac
gacggcctgatggatgtggtcactatcgacggaacagtcagtcgtgctacagcgcttaca
atgatgaacgaaatccccagtggtcgctttttcgacatgccagaccttaatgtccgcaaa
gcgtctgcgtttcgtctaattccccaccagaaggaaggctacatcagtattgatggtgag
cgggtgccttttgaagcgttccaagccgaggtccaccagggactgggcacaatactgacc
aaatcgggccgtgtctatgaggcggcaggtccccgctaa

DBGET integrated database retrieval system