KEGG   Penicillium chrysogenum: Pc13g14370Help
Entry
Pc13g14370        CDS       T01091                                 

Definition
Pc13g14370 (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pcs  Penicillium chrysogenum
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Pc13g14370
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Pc13g14370
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Pc13g14370
Lipid biosynthesis proteins [BR:pcs01004]
 Desaturase
  First
   Pc13g14370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 425 aa AA seqDB search
MAKSEPSKKLHISEKPVTFSNWYQHVNWVNTTLILIVPVGGVVAAFYTQLRAITATWAIL
YYFWTGLGITAGYHRLWAHRSYEAGLPIRIFLACVGGGAVQGSIRWWSSKHRAHHRWTDT
VKDPYSVMKGLWYSHFMWMVLNQNPKNRGRTDISDLNEDPVVVWQHKHYGSIILVFGMLF
PMLVAGLGWGDWKAGLVYAGILRFSFVQQATFCVNSLAHWLGEQPFDDRNSPRDHVITAL
VTLGEGYHNFHHEFPSDYRNAIEWWQYDPTKWSIWVWKQFGLATNLKQFRANEIEKGRIQ
QLQKKLDQKRARLDWGVPLDQLPVVDWDDFIAEARNGKALVAIAGVVHDVSRFIMEHPGG
KTLISSAIGKDATAMFNGGVYTHSNAAHNLLSSMRVGVIRGGGEVEIWRHRNNQKCEDSI
RKGLV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatctgagccaagtaaaaagctgcatatcagcgaaaagcccgtcaccttcagt
aactggtaccagcacgttaactgggtcaacacaaccctcatcctaattgtgcccgtcggt
ggcgtcgtcgctgcattctatacacagcttagggcgatcacagctacctgggcaattctc
tactacttctggaccgggctgggtattacagctggctaccatcgtctgtgggcgcacaga
tcttatgaagctggcctcccaattaggatattcctcgcctgtgtcggtggtggtgccgtc
caaggctctattcggtggtggagcagtaagcacagggcacaccaccgatggactgacaca
gtcaaggacccatacagcgtcatgaagggtctttggtattcacactttatgtggatggtt
ttaaatcaaaacccaaagaaccgtggcaggactgacatctccgacttgaacgaagacccg
gtggtcgtctggcagcacaagcactatggatctatcatcttggttttcgggatgctgttc
cctatgctcgttgctggtctgggatggggtgactggaaggcaggtcttgtgtatgctgga
attcttcgattttcatttgtgcagcaagcgaccttttgcgtcaattctctcgcccattgg
ttgggtgagcagccatttgatgataggaactcccctcgtgaccacgtcattactgcgcta
gtcactctcggcgaaggttaccacaacttccaccacgagttcccctccgactaccgcaac
gctatcgaatggtggcaatacgatcccacaaagtggtcaatctgggtgtggaaacagttc
ggtctggcaaccaacctcaagcagtttcgagccaacgaaatcgagaagggccgtattcaa
caactacagaagaagctcgaccagaagcgcgcgaggcttgattggggcgttcctctggat
cagctgcctgttgtcgactgggacgatttcattgcagaagctcggaatggcaaggctcta
gttgccattgctggtgttgttcacgacgtaagcagattcatcatggaacaccctggtggt
aaaaccctcatttcatcggccattggtaaggatgcgactgctatgttcaacggtggtgtc
tatactcattcgaatgccgctcacaaccttctttcctcgatgcgagttggagtaattcgc
ggtggtggtgaggttgagatttggcgtcaccgaaacaaccagaagtgtgaagactctata
cgaaagggtctagtatga

DBGET integrated database retrieval system