KEGG   Penicillium rubens: Pc13g15530Help
Entry
Pc13g15530        CDS       T01091                                 

Definition
(RefSeq) Pc13g15530
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
pcs  Penicillium rubens
Pathway
pcs00062  Fatty acid elongation
pcs01100  Metabolic pathways
pcs01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    Pc13g15530
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Pc13g15530
Lipid biosynthesis proteins [BR:pcs01004]
 Fatty acid synthase
  Component type
   Pc13g15530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest DUF915
Motif
Other DBs
NCBI-GeneID: 8315118
NCBI-ProteinID: XP_002559948
UniProt: B6H2T9
AA seq 324 aa AA seqDB search
MRSMTLLATLATNALAVALPWQSATDAASGTQLPLVIWHGLGDDFEREGLTEVAKLAEST
NPGTYVHLIRLAKDGSGDRSATFFGNVTEQIAQVCEQLAADPILSTAPAINALGFSQGGQ
FLRGYIERCNSPPVHNLVTFGSQHNGISAFESCAIDNWFCRGAEELLRSGRWTSFAQSRV
VPAQYFRDPEELDAYLEHSNFLADINNERVVKNETYKKNLASLNRFAMFMFEDDTVAVPK
QSAFFSEVNSTTGEVTPLHERPIYNEDWLGLKQLDEQGKLHFNTSPGQHMHLSAKTLRKA
FTQYFAPLEESRLSRPGLVVQRGL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcgttctatgacactgttggccacactggccaccaacgctctcgcagtcgcgctcccg
tggcagtccgccacagatgcagccagcggaacccagcttcccctcgtgatctggcatggt
ctgggcgatgacttcgaacgcgaagggctcactgaagttgctaagctagctgaatccacc
aacccaggcacatacgtgcacctcatccgactagccaaggacggcagcggagaccgctcc
gcaactttcttcggcaacgtaacggagcaaatcgcccaagtctgcgaacagcttgccgcg
gacccaatcctcagcacagcacccgccatcaacgcgctaggattttcgcagggtggccaa
tttctacgtgggtacatcgaacgctgcaatagcccgcccgtccacaacctcgtcacattt
ggcagccagcacaacggcatctcggcatttgagtcatgcgccatcgacaactggttctgc
agaggggcggaggaactactacgatcaggacggtggacgagctttgcgcagtcgcgcgtc
gtgccggcgcagtactttcgtgacccggaagagctggatgcgtacctcgagcacagcaat
ttcctagcggatatcaacaacgagcgcgtggtcaagaacgagacgtacaagaagaatctg
gcgtcgctgaatcgatttgcgatgttcatgttcgaggatgatactgttgccgttcccaag
cagagtgctttcttctccgaggttaattccactactggggaagtaacacctctgcatgag
aggccgatctacaatgaagattggctggggctgaagcagcttgacgagcaagggaagctg
cacttcaatacttcccctggacagcatatgcatctgtctgcgaagaccctgcgcaaggct
tttactcagtattttgctccgctggaagagtcgcgtctttcgagaccgggtctcgttgtg
cagcgcgggctatga

DBGET integrated database retrieval system