KEGG   Penicillium rubens: Pc14g00310Help
Entry
Pc14g00310        CDS       T01091                                 

Definition
(RefSeq) Pc14g00310
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pcs  Penicillium rubens
Pathway
pcs00052  Galactose metabolism
pcs00500  Starch and sucrose metabolism
pcs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Pc14g00310
   00500 Starch and sucrose metabolism
    Pc14g00310
Enzymes [BR:pcs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Pc14g00310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32C Glyco_hydro_32N YL1_C
Motif
Other DBs
NCBI-GeneID: 8314357
NCBI-ProteinID: XP_002560026
UniProt: B6H5K1
AA seq 580 aa AA seqDB search
MKLSTAITVGLAHRALAANPQIDYNSAPPNLSTLSNASLFDTWRPRAHLLPPSGKLGDPC
AHYTDPKTGLFHVGWLHDGISAATTDDLVTYKDLNPDGGPSITAGGKNDPLAVFDGSVIP
NGIDGMPTLIYTSVSYLPIHWSIPYTRGSETQSLAVSYDGGRNFTKLNQGPVIPAPPFAV
NITAFRDPYAFQSPLLDKSVNSTEGTWYITITGGVHDVGPCSFLYRQHDAGFQYWEYLGQ
WWNEPVNTTWGNGDWAGGWGFNFEVGNVFSLNAEGYSKDGEIFMTLGTEGSGQPIVPQVS
SIHDMLWVSGNVTNEGSVTFKPTMAGVLDWGLSGYAAAGQILPASSQASKKSGAPDRFIS
TIWLTGDLFELAKGFPTAQQNWTGALLLPRELNIRTIPNVVDNKLAREEFTSWRVSREGA
GQLDLETMGISLARETYSALTSGPSFVESGRTLSKAGSVPFNTSPSSKFFAMTANISFPA
TARDSGIQAGFQVLSSGLEATSIYYQFSNESIIVDRSNTSAASKTTHGILSDNEAGRLRL
FDVLENGKEKVETLELTVVVDNGILEVYANGRFALGTWAR
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtcaactgcaatcaccgtgggtttagcccaccgggcattggctgccaatccc
cagatcgactataactcggcaccaccaaacctcagtacgttgtcgaatgcatcccttttc
gacacatggagacccagagcccatctcctgcctccatctggcaagctaggtgatccgtgc
gcccattacaccgacccgaagactggtctcttccatgtgggttggcttcacgatggaatt
tcggcagctacaaccgatgatctcgttacctataaggacctcaatcccgatggtggcccg
tcaatcaccgcgggaggaaagaacgaccctcttgctgtctttgatggctccgtcattccg
aacggtatcgacggtatgccaacccttatatatacctctgtctcgtatctcccaattcac
tggtccatcccctacacccggggaagtgagacacaatccttggccgtttcctatgacggt
ggacgcaacttcaccaagctcaaccaagggcccgtgatcccagcgcctccatttgccgtg
aacatcaccgctttccgtgacccctacgctttccagagtccccttctggacaaatctgtc
aacagcaccgaaggaacctggtatatcaccatcacgggcggtgtccacgatgtcggacct
tgctcgttcctctaccgtcagcatgacgctggtttccaatactgggaatatctcggtcaa
tggtggaatgagcccgtcaataccacttggggcaacggtgactgggccggaggatggggc
ttcaattttgaggttggcaatgtcttctccctgaatgcggaggggtacagcaaggacggc
gaaatcttcatgactctcggtactgagggttcgggccaacccatcgttcctcaagtctct
tcaattcacgatatgctgtgggtgtctggaaatgtcacaaatgagggctccgtcaccttc
aagccaaccatggcgggtgtacttgactggggtctctctgggtatgctgctgcaggccag
atcttgccggcgagctctcaggcatccaaaaagagcggtgcccccgatcgttttatttcg
accatctggctcactggagacctatttgagctagcgaagggattccctaccgctcaacaa
aactggaccggcgccctcttgctgccacgagagctgaatatccgcactatccccaacgtg
gtggataacaagctggcgcgcgaggagttcacatcgtggcgcgtgtcccgcgaaggtgct
ggtcaactcgacctcgaaacaatgggaatttcacttgccagggagacttacagcgctctc
acatccggcccgtcttttgtcgagtctggtaggaccttgtcaaaggctgggtcggtgcca
ttcaacacctcaccctcgagcaagttctttgctatgacagcgaacatctctttccccgcc
accgcccgcgactctggtattcaagctggtttccaggtcttgtcctctggtcttgaagct
acaagtatctactaccaattctccaatgagtctatcatcgtcgaccgcagcaacacaagt
gccgcgtcgaaaaccactcatggaattctcagtgacaacgaggcgggtcgtctgcgcctc
tttgacgtcttggaaaatggtaaagaaaaggttgagacgttggagctcaccgtcgtggtg
gataatggaatactcgaagtttatgcgaacggacgctttgctctgggcacctgggctcgg
taa

DBGET integrated database retrieval system