KEGG   Penicillium rubens: Pc14g00540Help
Entry
Pc14g00540        CDS       T01091                                 

Definition
(RefSeq) Pc14g00540
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pcs  Penicillium rubens
Pathway
pcs00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pc14g00540
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Pc14g00540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 Cyt-b5 NAD_binding_6 MDMPI_N FAD_binding_9 GreA_GreB
Motif
Other DBs
NCBI-GeneID: 8310290
NCBI-ProteinID: XP_002560048
UniProt: B6H5N7
AA seq 475 aa AA seqDB search
MSVPETKELKAEWKADVELPEYTLKDVAAHNTKGDTWMVIHGQVFDLTTYLQDHPGGAEA
LIEVAGTDATAAYEDVGHSEDAREIMQPFLVGTLKDAQQYVRPKAVRVVSQKAPVEAGSS
SSTIKTIACALGGLIPVFYVFSKSNNLTTNLGAISQLIPHQLKSLRLPHGGFVNGFLAAS
AISTAVGVVVARQAGKFTKIDSGFMRYPPRIKSKKVIRADPHLTHGFLEPQQYQRLPLVE
KTELATNVYRFVFALPTATDVLGLPIGQHVAIRAVVDGTTVTRSYTPTSNNIDRGRIELV
IKCYPDGLLSGKYLAGLTVGDEVEFRGPKGSMRYTKGLCRKIGMVAGGTGITPMYQLIRA
ICENDTDTTEVSLVYANRSEADILLREELERFARQYPKNFKLWYMLDSAPEGWTYGSGYV
DQAVLAEQLPAASPDTKVMLCGPPGMVNATKKNLVALGFTKPGAVAKMTDQIFCF
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttccagaaacaaaagagctgaaggctgagtggaaggcagatgttgagctgcca
gagtatacattgaaagatgtagcggcacataacaccaagggtgatacctggatggtcatc
catggacaggtctttgacctcacaacatatctgcaagatcacccaggtggtgcagaggct
ctcatcgaggtagccggcaccgatgccacagcagcctatgaggatgtcgggcattctgaa
gacgcccgtgagatcatgcagccattcctggtgggaactttgaaggatgcccagcagtat
gtccgacccaaggcagtgcgtgtggtgtcccaaaaagcacccgtagaggccggctcctca
tcatcgaccatcaagacgatcgcttgtgctctgggtggactgatcccagtcttctacgtc
ttcagcaaaagcaacaatctcacaaccaacctgggagccatctcccaactgatccctcac
caactgaagagcttacgactgcctcatggaggcttcgtcaacggcttcttggccgcttct
gctatctccacagccgtgggagtagtggtagcacgacaggccggcaaattcaccaagatc
gactctgggttcatgcgttacccacctcgtattaagtcaaagaaggtgatccgtgccgat
ccacatctcacacacggtttcctcgagccgcaacaataccaacgcctgccactcgttgaa
aagaccgaactagcaacgaacgtctaccgtttcgtctttgcactgccaaccgccacagat
gtgttaggtctacccatcggtcaacacgtcgccatcagagctgttgtcgatggaacgacc
gtcactcgctcatacacccctacctccaacaacatcgaccggggccgcattgaactcgtg
atcaaatgctaccccgacggtctattgagtgggaaatatctggccggcctgaccgtgggc
gacgaagtcgagttccgcggacctaagggctctatgcgttacacaaaaggtctttgtcgc
aagatcggcatggtggccggcggcacaggcatcacgcccatgtaccagcttatccgggct
atctgcgagaacgacaccgacacgacggaagttagtctggtctacgcgaaccgcagcgag
gctgacattctcttacgcgaggagctggaacggttcgcgcgccaatacccaaagaacttc
aagctgtggtatatgctggactctgcgcccgagggctggacctatggatcgggatacgtg
gaccaggcagttctggcggagcagctccctgcagcatcgccagacactaaggtgatgtta
tgtgggccgcccggaatggtcaatgccactaagaagaatttggtggcgctgggctttacc
aagccaggggctgtggcgaagatgaccgatcaaatcttttgtttctag

DBGET integrated database retrieval system