KEGG   Penicillium chrysogenum: Pc14g00540Help
Entry
Pc14g00540        CDS       T01091                                 

Definition
Pc14g00540
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pcs  Penicillium chrysogenum
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pcs00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 475 aa AA seqDB search
MSVPETKELKAEWKADVELPEYTLKDVAAHNTKGDTWMVIHGQVFDLTTYLQDHPGGAEA
LIEVAGTDATAAYEDVGHSEDAREIMQPFLVGTLKDAQQYVRPKAVRVVSQKAPVEAGSS
SSTIKTIACALGGLIPVFYVFSKSNNLTTNLGAISQLIPHQLKSLRLPHGGFVNGFLAAS
AISTAVGVVVARQAGKFTKIDSGFMRYPPRIKSKKVIRADPHLTHGFLEPQQYQRLPLVE
KTELATNVYRFVFALPTATDVLGLPIGQHVAIRAVVDGTTVTRSYTPTSNNIDRGRIELV
IKCYPDGLLSGKYLAGLTVGDEVEFRGPKGSMRYTKGLCRKIGMVAGGTGITPMYQLIRA
ICENDTDTTEVSLVYANRSEADILLREELERFARQYPKNFKLWYMLDSAPEGWTYGSGYV
DQAVLAEQLPAASPDTKVMLCGPPGMVNATKKNLVALGFTKPGAVAKMTDQIFCF
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttccagaaacaaaagagctgaaggctgagtggaaggcagatgttgagctgcca
gagtatacattgaaagatgtagcggcacataacaccaagggtgatacctggatggtcatc
catggacaggtctttgacctcacaacatatctgcaagatcacccaggtggtgcagaggct
ctcatcgaggtagccggcaccgatgccacagcagcctatgaggatgtcgggcattctgaa
gacgcccgtgagatcatgcagccattcctggtgggaactttgaaggatgcccagcagtat
gtccgacccaaggcagtgcgtgtggtgtcccaaaaagcacccgtagaggccggctcctca
tcatcgaccatcaagacgatcgcttgtgctctgggtggactgatcccagtcttctacgtc
ttcagcaaaagcaacaatctcacaaccaacctgggagccatctcccaactgatccctcac
caactgaagagcttacgactgcctcatggaggcttcgtcaacggcttcttggccgcttct
gctatctccacagccgtgggagtagtggtagcacgacaggccggcaaattcaccaagatc
gactctgggttcatgcgttacccacctcgtattaagtcaaagaaggtgatccgtgccgat
ccacatctcacacacggtttcctcgagccgcaacaataccaacgcctgccactcgttgaa
aagaccgaactagcaacgaacgtctaccgtttcgtctttgcactgccaaccgccacagat
gtgttaggtctacccatcggtcaacacgtcgccatcagagctgttgtcgatggaacgacc
gtcactcgctcatacacccctacctccaacaacatcgaccggggccgcattgaactcgtg
atcaaatgctaccccgacggtctattgagtgggaaatatctggccggcctgaccgtgggc
gacgaagtcgagttccgcggacctaagggctctatgcgttacacaaaaggtctttgtcgc
aagatcggcatggtggccggcggcacaggcatcacgcccatgtaccagcttatccgggct
atctgcgagaacgacaccgacacgacggaagttagtctggtctacgcgaaccgcagcgag
gctgacattctcttacgcgaggagctggaacggttcgcgcgccaatacccaaagaacttc
aagctgtggtatatgctggactctgcgcccgagggctggacctatggatcgggatacgtg
gaccaggcagttctggcggagcagctccctgcagcatcgccagacactaaggtgatgtta
tgtgggccgcccggaatggtcaatgccactaagaagaatttggtggcgctgggctttacc
aagccaggggctgtggcgaagatgaccgatcaaatcttttgtttctag

DBGET integrated database retrieval system